KEGG   Sneathia amnii: VC03_01180Help
Entry
VC03_01180        CDS       T03854                                 

Definition
(GenBank) hypothetical protein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
sns  Sneathia amnii
Pathway
sns00770  Pantothenate and CoA biosynthesis
sns01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sns00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    VC03_01180
Enzymes [BR:sns01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     VC03_01180
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     VC03_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein XdhC_C DRE2_N
Motif
Other DBs
NCBI-ProteinID: AKC95189
UniProt: A0A0E3UTK1
Position
233673..234872
Genome map
AA seq 399 aa AA seqDB search
MKMVLIIVSSSIACYKAVDVCSSLKKLGYNVKVIMTKNATKMISPLIFETLTKNKVYVDM
FCDKDSNYVSHIQLVKEASKVIVLPATANLIAKMANGIADDFASTALLVAKPKDIMVFPA
MNTNMYENCITQKNISTLRNYGMSIIEPVTGHLACDDIGKGKLPGVDFVLDNIVFFLEKT
NEYMNKNILITAGGTREKIDPVRYITNNSSGKMGYSLAKMASLMGANVTLVSTRRNLKLP
VNLKEVIYCDSAQEMYDIVMSKKNNMDYIIKCAAVSDFKVKNVCDKKIKKDDMKEFKIDL
ELNKDILLELSKTENRHFTLVGFAAESNNIMENAKKKLKKKNLDYLILNDISDKSIGFNS
DYNEVYVLSKNDEVKKIQKDTKDNIAKKILESIKENNYE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggttttaataatagtaagcagtagcatagcttgctataaggcagttgatgtt
tgttctagcttaaaaaaactagggtataacgttaaggttattatgacaaagaatgctact
aagatgataagtccattaatatttgaaactttaactaagaataaggtatatgtagatatg
ttttgcgataaggactctaattatgtatcgcatatacaattagtaaaagaagcaagtaaa
gtgatagtattgcctgcaacagcaaatttgatagcaaaaatggcaaatggaatagcagat
gattttgcaagcacagcacttttggttgcaaagcctaaggatattatggtgtttcctgca
atgaatacaaatatgtatgaaaattgtataacacaaaaaaatatatctacattaagaaat
tatggaatgagtattattgaaccagtaactggtcatttagcctgtgatgatatagggaaa
gggaagttacctggtgtagactttgtactagataatattgtatttttcttagaaaaaaca
aatgaatatatgaataaaaatatattaattacagcaggtggaacaagagaaaaaattgat
ccagttagatatattactaataactctagtggtaaaatgggatatagcttagctaagatg
gcaagtttaatgggagctaatgttacattagtttcaacaagaagaaatttaaagttacct
gtaaatttaaaagaagtaatatactgtgacagtgcacaagaaatgtatgatatagtaatg
agcaagaaaaacaatatggactatattataaaatgtgctgctgtatcagattttaaagtg
aaaaatgtatgcgataagaagataaaaaaagatgatatgaaagaatttaagatagactta
gagttaaataaagatatacttttagagctatctaaaacagaaaatagacattttacctta
gtaggatttgctgcagaatcaaataatattatggaaaatgcaaaaaagaaattaaaaaag
aaaaatctagattatttaatactaaatgatatatccgacaagagtataggctttaattcg
gactataacgaagtatatgtattaagtaagaatgatgaagtaaaaaagatacaaaaggat
acaaaagataatatagcaaagaaaatattagaaagtataaaggagaacaactatgaatga

DBGET integrated database retrieval system