KEGG   Sneathia amnii: VC03_04065Help
Entry
VC03_04065        CDS       T03854                                 

Definition
(GenBank) hypothetical protein
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
sns  Sneathia amnii
Pathway
sns00051  Fructose and mannose metabolism
sns00520  Amino sugar and nucleotide sugar metabolism
sns01100  Metabolic pathways
sns01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sns00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VC03_04065
   00520 Amino sugar and nucleotide sugar metabolism
    VC03_04065
Enzymes [BR:sns01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     VC03_04065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD MannoseP_isomer ID Profilin
Motif
Other DBs
NCBI-ProteinID: AKC95679
UniProt: A0A0E3UTY7
Position
complement(807824..808789)
Genome map
AA seq 321 aa AA seqDB search
MNIAIIMAGGSGTRFWPLSTKDTPKQLLKLFSDKTLLEETIDRLNRTGIYDKVYIVTGKG
LEKRIRQTLKDFDNILIEPVSKDTSFCIAYSVKKIVDIYGIDTHISIFPSDHLIRNDELF
KESIEKALTFKDNIVIMGIKPQYPETAYGYIKYRDNDVIEFREKPNRETAEKYLEEGNYL
WNSGMLFASSKVILGEIEKYLPKHYALSLDAERISFDIGVLEKTNLCKVVPVSFDWNDVG
SFSSLDKVFEKNEQDSIIISKDKYLGLQSSKNIVINKEDGKNIVVVGLDDLIVVNTKDNL
LICPKSKDQEIKKIAGIIDEK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagcgataattatggcaggtggatctggtacaagattttggccattatcaact
aaagacactccaaagcaattattaaaattgttttcagataagacactattagaagaaact
atagatagattaaatagaactggaatatatgataaggtgtatatagtaacagggaaaggt
ttagaaaaaagaataagacaaactttaaaagattttgataatatattaatagaacctgta
tcaaaagatacatcattttgtatagcgtattcagtaaaaaaaattgtagatatatatggt
attgatacacatatttctatcttcccatcagatcatttaattagaaatgatgaactgttt
aaggaaagtatagaaaaggccttaacttttaaagacaatatcgttatcatgggaataaaa
cctcaatatcctgaaacagcttatgggtatataaagtacagggataatgatgttatagaa
ttccgtgaaaaacctaatagggaaacagcagaaaaatacttagaagaaggtaactatcta
tggaatagtggtatgctatttgcaagttctaaagtaatattaggagaaatagaaaagtac
ttacctaagcactatgcattatcacttgatgcagaacgtattagttttgacataggggtc
ttagaaaagacaaatttatgtaaagttgtaccagttagctttgactggaatgatgttgga
agttttagctcattagataaagtttttgaaaaaaatgaacaagactcgataataattagc
aaggataaatatcttgggttacaaagtagcaagaatattgtaataaacaaagaagatggg
aaaaatattgttgttgttggactagatgacttaattgttgtaaatacaaaggacaacctt
ttaatttgccctaaatcaaaagaccaagagataaaaaaaatagcaggtataatagatgaa
aagtag

DBGET integrated database retrieval system