KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_0473Help
Entry
SPT_0473          CDS       T00875                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B)
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Pathway
snt00970  Aminoacyl-tRNA biosynthesis
snt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPT_0473
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:snt03029]
    SPT_0473
Enzymes [BR:snt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPT_0473
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPT_0473
Mitochondrial biogenesis [BR:snt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPT_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACO24019
UniProt: C1CPU6
Position
complement(434201..435643)
Genome map
AA seq 480 aa AA seqDB search
MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGI
KAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAG
ISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNVRKGLEYEVQRQAEILRSG
GQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFEISDEWIEEMRTELPEFPKE
RRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALGGDAKQVSNWLQGEVAQFLNAEGKT
LEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAVL
IPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATKGQANPQVALKLLAQELAKLKEN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacagtcatcggacttgaagtccacgtagagctcaacaccaattcaaaa
atcttctcacctacttctgcccacttcggaaatgatcaaaatgccaacactaacgtgatt
gactggtctttcccaggagttctgccagttctcaataaaggggttgtcgatgccggaatc
aaggctgctcttgccctcaacatggacatccacaaaaagatgcactttgaccgcaagaac
tacttctaccctgataatcccaaagcctaccaaatttctcagtttgatgagccaatcggt
tataacggctggattgaagtcgaactagaagacggtacgaccaagaaaatcggtatcgaa
cgtgcccacctagaggaagacgctggtaaaaacacccatggtacagatggctactcttat
gttgacctcaaccgccaaggggttcccttgattgagattgtatctgaggcagatatgcgt
tctcctgaagaagcctatgcttatctgacagccctcaaggaagttatccagtacgctggc
atttctgacgttaagatggaggaaggttcgatgcgtgtggatgccaacatctcccttcgt
ccttatggtcaagagaaattcggtaccaagactgaattgaagaacctcaactccttctca
aacgttcgtaaaggtcttgaatacgaagtccaacgccaggctgaaattcttcgctcaggt
ggtcaaatccgccaagaaacacgccgttacgatgaagcgaataaagcaaccatcctcatg
cgtgtcaaggaaggggctgctgactaccgctacttcccagaaccagacctacccctcttt
gaaatttctgacgagtggattgaggaaatgcggactgagttgccagagtttccaaaagaa
cgtcgtgcgcgttatgtatctgaccttggtttatcagactacgatgctagtcagttgact
gctaataaagtcacttctgacttctttgaaaaagctgttgccctaggtggtgatgccaaa
caagtctctaactggctccaaggggaagtcgctcagttcttgaatgctgaaggtaaaaca
ctggaacaaatcgaattgacaccagaaaacttggttgaaatgattgccatcatcgaagac
ggtactatttcatctaagattgccaagaaagtctttgtccatctagctaaaaatggcggt
ggcgcgcgtgaatacgtggaaaaagcaggtatggttcaaatttcagatccagctgttttg
attccaattatccaccaagtctttgcggataacgaagctgctgttgccgacttcaagtca
ggcaaacgtaatgcagacaaggccttcacaggattccttatgaaggcaaccaaaggccaa
gccaacccacaagttgcccttaaactacttgcacaggaattggcgaagttgaaagaaaac
tag

DBGET integrated database retrieval system