KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_0474Help
Entry
SPT_0474          CDS       T00875                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADTsubunit A)
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Pathway
snt00970  Aminoacyl-tRNA biosynthesis
snt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPT_0474
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:snt03029]
    SPT_0474
Enzymes [BR:snt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPT_0474
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPT_0474
Mitochondrial biogenesis [BR:snt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPT_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACO24188
UniProt: C1CPU7
Position
complement(435643..437109)
Genome map
AA seq 488 aa AA seqDB search
MTFNNKTIEELHNLLVSKEISATELTQATLENIKSREEALNSFVTIAEEQALVQAKAIDE
AGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFDATAVANAKTKGMIVVGKT
NMDEFAMGGSGETSHYGATKNAWDHSKVPGGSSSGSAAAVASGQVRLSLGSDTGGSIRQP
AAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENALLLNAIASEDAKDSTSAP
VRIADFTSKIGQDIKGMKIALPKEYLGEGINPEVKETILNAAKHFEKLGAIVEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDATNLDEIYVNSRSQGFGEEVKRRIMLG
TFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILGPTAPSVAYDLDSLNHDPVAMY
LADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKHSEETIYQVAAAFEATTGYHKQQ
PVIFGGDN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacaataaaactattgaagagttgcacaatctccttgtctctaaggaaatt
tctgcaacagaattgacccaagcaacacttgaaaatatcaagtctcgtgaggaagccctc
aattcatttgtcaccatcgctgaggagcaagctcttgttcaagctaaagccattgatgaa
gctggaattgatgctgacaatgtcctttcaggaattccacttgctgttaaggataacatc
tctacagacggtattctcacaactgctgcctcaaaaatgctctacaactatgagccaatc
tttgatgcgacagctgttgccaatgcaaaaaccaagggcatgattgtcgttggaaagacc
aacatggacgaatttgctatgggtggttcaggtgaaacttcacactacggagcaactaaa
aacgcttgggaccacagcaaggttcctggtgggtcatcaagtggttctgccgcagctgta
gcctcaggacaagttcgcttgtcacttggttctgatactggtggttccatccgccaacct
gctgccttcaacggaatcgttggtctcaaaccaacctacggaacagtttcacgtttcggt
ctcattgcctttggtagctcattagaccagattggaccttttgctcctactgttaaggaa
aatgccctcttgctcaacgctattgccagcgaagatgctaaagactctacttctgctcct
gtccgcatcgccgactttacttcaaaaatcggccaagacatcaagggtatgaaaatcgct
ttgcctaaggaatacctcggtgaaggaattaacccagaggttaaggaaaccattctaaat
gccgctaaacactttgaaaaattgggtgctattgtcgaagaagtcagccttcctcactct
aaatacggagttgccgtatactacatcatcgcttcatcagaagcttcatcaaacttgcaa
cgctttgacggtatccgttacggctatcgcgcagaagatgcaaccaaccttgatgaaatc
tatgtaaacagccgaagccaaggttttggtgaagaagtgaagcgccgtatcatgctgggt
actttcagtctttcatcaggttactacgatgcctactataagaaggctggacaggtccgt
acacttatcattcaagatttcgaaaaagtcttcgcggattacgatttgattttgggtcca
actgctccaagtgttgcctatgacttggattctctcaaccatgacccagttgccatgtac
ttagccgacctattgaccatacctgtaaacttggcaggactgcctggaatttcgattcct
gctggattctctcaaggtctacctgtcggtctgcaattgattggtcccaagcactctgag
gaaaccatttaccaagttgctgctgcctttgaagcaacaacaggctaccacaaacaacaa
cccgtgatttttggaggtgacaactaa

DBGET integrated database retrieval system