KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_0800Help
Entry
SPT_0800          CDS       T00875                                 

Definition
(GenBank) glycyl-tRNA synthetase alpha chain (Glycine--tRNA ligasealpha chain) (GlyRS)
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Pathway
snt00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:snt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPT_0800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:snt01007]
    SPT_0800
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snt03016]
    SPT_0800
Enzymes [BR:snt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     SPT_0800
Amino acid related enzymes [BR:snt01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   SPT_0800
Transfer RNA biogenesis [BR:snt03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPT_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: ACO22411
UniProt: C1CQP3
Position
757409..758326
Genome map
AA seq 305 aa AA seqDB search
MSKKLTFQEIILTLQQFWNDQGCMLMQAYDNEKGAGTMSPYTFLRAIGPEPWNAAYVEPS
RRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLESLEKLGINPLEHDIRFVEDNWE
NPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLATGPVTAEVTYGLERLASYIQEVDSVYD
IEWADGVKYGEIFIQPEYEHSKYSFEISDQEMLLENFDKFEKEAGRALEEGLVHPAYDYV
LKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVAERKRLGYPLLDEETRVKLL
AEDAE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaaattgactttccaggaaatcatccttactttgcaacaattttggaatgac
caaggttgtatgcttatgcaggcttatgataatgaaaaaggtgcgggaacaatgagtcct
tacactttccttcgtgctatcggacctgagccatggaatgcagcttatgtagagccatca
cgtcgtcctgctgacggtcgttatggggaaaaccctaaccgtctctaccaacaccaccaa
ttccaggtggtcatgaagccttctccatcaaatatccaagaactttaccttgaatctttg
gaaaaattgggaatcaatcctttggagcacgatattcgttttgttgaggacaactgggaa
aacccatcaactggttcagctggtcttggttgggaagtttggcttgacggaatggaaatc
actcagttcacttatttccaacaagtcggtggattggcaactggccctgtgactgcggaa
gttacctatggtttggagcgcttggcttcttacattcaagaagtagactctgtctatgat
atcgagtgggctgatggtgtaaaatacggagaaatctttatccagcctgagtatgagcac
tcaaaatattcatttgaaatttcggaccaagaaatgttgcttgaaaactttgataagttt
gaaaaagaagctggtcgtgcattagaagaaggcttggtacaccctgcctatgactatgtt
ctcaaatgttcacatacctttaatctgcttgacgcgcgtggtgccgtatctgtaacagag
cgtgcaggctatatcgctcgtatccgtaacttggcccgtgttgtagccaaaacctttgtt
gcagaacgcaaacgcctaggttacccacttttggatgaagaaacacgagttaaactttta
gcagaagacgcagaatag

DBGET integrated database retrieval system