KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_0997Help
Entry
SPT_0997          CDS       T00875                                 

Gene name
coaC
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Pathway
snt00770  Pantothenate and CoA biosynthesis
snt01100  Metabolic pathways
Module
snt_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:snt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SPT_0997 (coaC)
Enzymes [BR:snt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SPT_0997 (coaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DrsE SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: ACO22848
Position
complement(941552..942103)
Genome map
AA seq 183 aa AA seqDB search
MANILLAVTGSIASYKSADLVSSLKKQGHQVTVLMTQAATEFIQPLTLQVLSQNPVHLDV
MKEPYPDQVNHIELGKKADLFIVVPATANTIAKLAHGFADNMVTSTALALPSHIPKLITP
AMNTKMYDHPVTQNNLKTLETYGYQLIAPKESLLACGDHGRGALADLTIILERIKETIDE
KTL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacattctcttggctgtaacgggttcaatcgcctcttataagtcggcagattta
gtcagttctctaaaaaaacaaggccatcaagtcactgtcttaatgactcaggctgctaca
gagtttatccaacctttgacactacaggtactctcacagaatcctgtccacttggatgtc
atgaaggaaccctatcctgatcaggtcaatcatatcgaacttggaaaaaaagcagattta
tttatcgtggtacctgcaactgctaacactattgcaaaactagctcacggatttgcggac
aacatggtaaccagtacagctctagccctaccaagtcatattcccaaactaataactcct
gctatgaatacaaaaatgtatgaccatccagtaactcagaataatctgaaaacattagaa
acctacggctatcagctgattgctcctaaggaatccctactagcttgtggagaccacgga
cgaggagctttagctgacctcacaattattttagaaagaataaaggaaactatcgatgaa
aaaacgctctaa

DBGET integrated database retrieval system