KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_1664Help
Entry
SPT_1664          CDS       T00875                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Pathway
snt00900  Terpenoid backbone biosynthesis
snt01110  Biosynthesis of secondary metabolites
snt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:snt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPT_1664
Enzymes [BR:snt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SPT_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ACO22286
Structure
PDB: 

Position
complement(1589000..1590274)
Genome map
AA seq 424 aa AA seqDB search
MKISWNGFSKKSYQERLELLKAQALLSPERQASLEKDEQMSVTVADQLSENVVGTFSLPY
SLVPEVLVNGQEYTVPYVTEEPSVVAAASYASKIIKRAGGFTAQVHQRQMIGQVALYQVA
NPKLAQEKIASKKAELLELANQAYPSIVKRGGGARDLHVEQIKGEPDFLVVYIHVDTQEA
MGANMLNTMLEALKPVLEELSQGQSLMGILSNYATDSLVTASCRIAFRYLSRQKDQGREI
AEKIALASQFAQADPYRAATHNKGIFNGIDAILIATGNDWRAIEAGAHAFASRDGRYQGL
SCWTLDLEREELVGEMTLPMPVATKGGSIGLNPRVALSHDLLGNPSARELAQIIVSIGLA
QNFAALKALVSTGIQQGHMKLQAKSLALLAGASESEVAPLVERLISDKTFNLETAQRYLE
NLRS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagttggaatggattttctaaaaaatcataccaagagcgcctcgagctgtta
aaagctcaggcgctccttagtcctgagagacaagctagtctggagaaggatgaacagatg
agcgtgactgtggcagaccagctgagtgagaatgtagtgggaactttttctctgccttat
tcactggttccggaggtacttgtcaacggtcaggaatacaccgttccctatgtgacagaa
gaaccctctgtggttgcggcggccagctatgccagcaaaatcatcaagcgtgcaggtggt
tttactgcacaagtccatcagcgacagatgattgggcaggtagccctttatcaagttgct
aatcctaaactagcgcaagagaagattgccagcaagaaagcggagctcttggagcttgcc
aatcaagcctatccttctatcgttaaacgtggaggtggggcgcgtgatctgcatgtcgag
cagataaaaggcgaaccagactttctcgttgtttatattcatgtcgatacccaggaagcc
atgggtgccaatatgctcaacaccatgctggaagccttgaaaccagtcttagaagaactc
agtcagggacagagtctcatgggaatcctgtccaactacgcgaccgattctctggtgact
gcaagctgtcgcatcgcctttcgctacttgagccgccaaaaggatcaaggacgagagatt
gcggagaaaattgcgttggctagtcagtttgcgcaggctgatccttaccgagctgctact
cataataaaggaatttttaatggtattgatgcgattttgattgccactggtaatgactgg
cgtgccatcgaagctggggcccatgcctttgccagtcgagatggacgctatcaaggtctt
agttgctggacgctggaccttgaaagagaagaattggtcggtgagatgaccctgcccatg
cctgtagcgactaagggtggctctatcggcctcaacccacgtgtagctctcagtcatgat
ctactaggaaatccttctgccagagaattagcccagattatcgtgtccatcggtcttgcc
caaaattttgcagccctcaaagccttggtaagtacgggcatccagcaaggccacatgaaa
ctacaggccaaatccctagctctcctagctggggctagtgaatctgaagttgctccccta
gtagagcgcctcatctcagataaaacctttaacctagagacagcccagcgctatctcgaa
aatttaagatcataa

DBGET integrated database retrieval system