KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_1936Help
Entry
SPT_1936          CDS       T00875                                 

Definition
(GenBank) nucleoside diphosphate kinase (NDK) (NDP kinase)(Abnormal wing disks protein) (Killer of prune protein)
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Pathway
snt00230  Purine metabolism
snt00240  Pyrimidine metabolism
snt01100  Metabolic pathways
snt01110  Biosynthesis of secondary metabolites
snt01130  Biosynthesis of antibiotics
Module
snt_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
snt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
snt_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:snt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPT_1936
   00240 Pyrimidine metabolism
    SPT_1936
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:snt04131]
    SPT_1936
Enzymes [BR:snt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SPT_1936
Membrane trafficking [BR:snt04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SPT_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ACO22333
UniProt: C1CTL2
Position
complement(1812995..1813408)
Genome map
AA seq 137 aa AA seqDB search
MEQTFFIIKPDGVKRGLVGEVLKRIEQRGFTIEKLEFRSQVSEELIDQHYQDLVGQSFYP
PIREFMTSGPVLVGVISGPKVIETWRTMMGATRPEEALPGTIRGDFAKAAGENEIIQNVV
HGSDSEESAKREIALWF
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacattctttatcatcaaaccagatggtgtaaaaagagggctagtgggtgaa
gtgttaaagcgcatcgaacaacgtggatttacaatcgaaaaattggagtttcgttcacag
gtttcagaagagttgattgaccagcactatcaggacttggttggtcagagtttttaccca
ccgattcgtgaattcatgacttcaggtccagttcttgtgggtgtcatttctggtcccaaa
gtaatcgaaacttggcggaccatgatgggtgcaactcgtccagaagaagctttaccaggc
actattcgaggtgattttgcaaaagctgctggagaaaatgagattatccaaaatgttgta
catggttcagattcagaagagtcagctaagcgagaaattgctctttggttttaa

DBGET integrated database retrieval system