KEGG   Streptococcus pneumoniae Taiwan19F-14 (serotype 19F): SPT_2037Help
Entry
SPT_2037          CDS       T00875                                 

Gene name
rnpA
Definition
(GenBank) ribonuclease P protein component
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
snt  Streptococcus pneumoniae Taiwan19F-14 (serotype 19F)
Brite
KEGG Orthology (KO) [BR:snt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snt03016]
    SPT_2037 (rnpA)
Enzymes [BR:snt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     SPT_2037 (rnpA)
Transfer RNA biogenesis [BR:snt03016]
 Prokaryotic Type
  5'processing factors
   Ribonucrease P
    SPT_2037 (rnpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_P
Motif
Other DBs
NCBI-ProteinID: ACO22962
UniProt: C1CTU8
Position
complement(1899795..1900166)
Genome map
AA seq 123 aa AA seqDB search
MKKNFRVKREKDFKAIFKEGTSFANRKFVVYQLENQKNHFRVGLSVSKKLGNAVTRNQIK
RRIRHIIQNAKGSLVEDVDFVVIARKGVETLGYAEMEKNLLHVLKLSKIYREGNGSEKET
KVD
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaaactttcgtgtaaaaagagagaaagattttaaggcgattttcaaggagggg
acaagttttgctaatcgcaaatttgtggtctaccaattagaaaaccagaaaaaccatttt
cgagtaggtctatcagttagcaaaaaactggggaatgccgtcactagaaatcaaattaag
cgacggattcggcatattatccagaatgcaaaagggagtctggtagaagatgtcgacttt
gttgtcattgctcgaaaaggagtcgaaaccttgggatacgcagagatggagaaaaatcta
ctccatgtattaaaattatcaaagatttaccgggaaggaaatgggagtgaaaaagaaact
aaagttgactag

DBGET integrated database retrieval system