KEGG   Streptococcus pneumoniae SPNA45: SPNA45_01232Help
Entry
SPNA45_01232      CDS       T02245                                 

Gene name
proB
Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
snu  Streptococcus pneumoniae SPNA45
Pathway
snu00330  Arginine and proline metabolism
snu00332  Carbapenem biosynthesis
snu01100  Metabolic pathways
snu01130  Biosynthesis of antibiotics
snu01230  Biosynthesis of amino acids
Module
snu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:snu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPNA45_01232 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SPNA45_01232 (proB)
Enzymes [BR:snu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPNA45_01232 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CCM08517
Position
1244860..1245969
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLNRGAIPIINENDCVVIDEVKVGDNDTLSAQVAAMVQADLLVLLTDVDGLYTGNPNS
DPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDS
MIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQHGKSLLLSGI
VEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDMLRSQKAKGVLIYRDDWISITP
EIQLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggatattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggcgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaagattgctgataaacaggcttcagcagcggtagggcaggga
cttttgttggaagaatatacgaccaatcttctcttgcgtcaaatcgtttctgcacaaatc
ttgctgacccaagatgactttgtggataagcgtcgttataaaaatgcccatcaggctttg
tcggttttactcaaccgtggggcaattcctatcatcaatgagaatgattgtgtcgttatt
gatgaggtcaaggttggggacaatgacactctaagtgcccaagtagcggcgatggtccaa
gcagaccttttggttctcttgacagatgtggacggtctctatactggaaatcctaattca
gatccaagagccaaacgcttggagagaatcgagaccatcaatcgtgagattattgatatg
gctggtggagctggttcgtcaaacggaactgggggtatgttaaccaaaatcaaggctgca
actatcgcgacggaatcaggagttcctgtttatatctgctcatccttgaaatcagattcc
atgattgaggcggcagaggagaccgaggatggttcttactttgttgctcaagagaagggg
cttcgtacccagaaacaatggcttgccttctatgctcagagtcaaggttctatttgggtt
gataaaggggctgcggaagctctctctcaacatggaaagagtcttctcttatctggtatc
gttgaagcagaaggagtcttttcttacggtgatatcgtgacagtatttgataaggaaagt
ggaaaatcacttggaaaaggacgcgtgcaatttggagcatctgctttggaggatatgttg
cgttctcaaaaagccaagggtgtcttgatttaccgtgacgactggatttccattactcct
gaaatccaactactttttacagaattttag

DBGET integrated database retrieval system