KEGG   Streptococcus pneumoniae INV200 (serotype 14): SPNINV200_15480Help
Entry
SPNINV200_15480   CDS       T02073                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
snv  Streptococcus pneumoniae INV200 (serotype 14)
Pathway
snv00900  Terpenoid backbone biosynthesis
snv01110  Biosynthesis of secondary metabolites
snv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:snv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPNINV200_15480 (mvaA)
Enzymes [BR:snv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SPNINV200_15480 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CBW35181
Structure
PDB: 

Position
complement(1577291..1578565)
Genome map
AA seq 424 aa AA seqDB search
MKISWNGFSKKSYQERLELLKAQALLSPERQASLEKDEQMSVTVADQLSENVVGTFSLPY
SLVPEVLVNGQEYTVPYVTEEPSVVAAASYASKIIKRAGGFTAQVHQRQMIGQVALYQVA
NPKLAQEKIASKKAELLELANQAYPSIVKRGGGARDLHVEQIKGEPDFLVVYIHVDTQEA
MGANMLNTMLEALKPVLEELSQGQSLMGILSNYATDSLVTASCRIAFRYLSRQKDQGREI
AEKIALASQFAQADPYRAATHNKGIFNGIDAILIATGNDWRAIEAGAHAFASRDGRYQGL
SCWTLDLEREELVGEMTLPMPVATKGGSIGLNPRVALSHDLLGNPSARELAQIIVSIGLA
QNFAALKALVSTGIQQGHMKLQAKSLALLAGASESEVAPLVERLISDKTFNLETAQRYLE
NLRS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagttggaatggattttctaaaaaatcataccaagagcgcctcgagctgcta
aaagctcaggcgctccttagtcctgagagacaagctagtctggagaaggatgaacagatg
agtgtgactgtggcagaccagctgagtgagaatgtggtgggaactttttctctgccttat
tcgctggttccggaggtacttgtcaacggtcaggaatacaccgttccctatgtgacagaa
gaaccctctgtggttgcggcggccagctatgccagcaaaatcatcaagcgtgcaggtggt
tttactgcacaagtccatcagcgccagatgattgggcaggtagccctttatcaagttgct
aatcctaaactagcgcaagagaagattgccagcaagaaagcggagctcttggagcttgcc
aatcaagcctatccttctatcgttaaacgtgggggtggggcgcgtgatctgcatgtcgag
cagataaaaggcgaaccagactttctcgttgtttatattcatgtcgatacccaggaagcc
atgggtgccaatatgctcaacaccatgctggaagccttgaaaccagtcttagaagaactc
agtcagggacagagtctcatgggaatcctgtccaactacgcgactgattctctggtgact
gcaagctgtcgcatcgcctttcgctacttgagccgccaaaaggatcaaggacgagagatt
gcggagaaaattgcgttggctagtcagtttgcgcaggctgatccttaccgagctgctact
cataataaaggaatttttaatggtattgatgcgattttgattgccactggtaatgactgg
cgtgccatcgaagctggggcccatgcctttgccagtcgagatggacgctatcaaggtctt
agctgctggacgctggaccttgaaagagaagaattggtcggtgagatgaccctgcccatg
cctgtagcgactaagggtggctctatcggcctcaacccacgtgtagctctcagtcatgat
ctactaggaaatccttctgccagagaattagcccagattatcgtgtccatcggtcttgcc
caaaattttgcagccctcaaagccttggtaagtacgggcatccagcaaggccacatgaaa
ctacaggccaaatctctagctctcctagctggggctagtgaatctgaagttgctccccta
gtagagcgcctcatctcagataaaacctttaacctagagacagcccagcgctatctcgaa
aatttaagatcataa

DBGET integrated database retrieval system