KEGG   Streptomyces niveus: BBN63_05255Help
Entry
BBN63_05255       CDS       T04887                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
snw  Streptomyces niveus
Pathway
snw00220  Arginine biosynthesis
snw00330  Arginine and proline metabolism
snw01100  Metabolic pathways
snw01110  Biosynthesis of secondary metabolites
snw01130  Biosynthesis of antibiotics
snw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BBN63_05255
   00330 Arginine and proline metabolism
    BBN63_05255
Enzymes [BR:snw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BBN63_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AQU65738
UniProt: A0A1U9QN85
Position
complement(1268773..1269669)
Genome map
AA seq 298 aa AA seqDB search
MRNIVVIDAPSNLGLRPPAPGTVPGCYKLAGAMREQRIVQRLGAFEGGVVVPPRYDRGDW
KEGDGVFNAAAIAAYTPRLADRIEHHVRAGDFPLVLGGDCSIQLGASLALRRIGRYGIAA
IDGSADFRHTGNSPSVGAAGGEELAIATGRGQSDLSDIEGLRPYIRDEDVRLFGIRDDDE
DREELARLRIPTVSVGEFRRWGTDELAGAVLQTLELPVTEGFWVHLDADVLDPEVMPAVD
APDPGGLLPDELRTLLTILVRSDRCVGLNLTIYDPDLDPDGTAGALLADIVVAALTQD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcggaatatcgtggtgatcgacgcgccctccaacctcggcctccggccacccgctccc
ggcaccgtacccggctgctacaagctcgccggcgccatgcgcgagcagcgcatcgtgcag
cggctcggcgccttcgagggcggggtcgtcgtcccgccgcgctacgaccggggcgactgg
aaggaaggcgacggggtcttcaacgccgccgcgatcgccgcgtacacacccaggctcgcg
gaccgcatcgagcaccacgtacgggccggcgacttccccctcgtactcggcggcgactgc
tccatccagctcggcgcctccctcgcgctgcgccggatcgggcggtacggcatcgccgcg
atcgacggctccgccgacttccggcacaccggcaactccccgtccgtcggcgcggcgggc
ggcgaggaactggccatcgccaccgggcgcgggcagagcgacctcagcgacatcgaaggg
ctgcgcccctacatccgcgacgaggacgtgcgcctcttcggtatccgcgacgacgacgag
gaccgcgaggaactggcccggctgaggatccccaccgtctccgtcggcgagttccgccga
tggggcaccgacgaactcgcgggcgccgtactccagacgctggaactccccgtcaccgaa
ggcttctgggtgcacctcgacgcggacgtactcgaccccgaggtgatgccggccgtcgac
gcccccgaccccggcgggctgctccccgacgagctgcggacactgctgacgatcctggtg
cgttcggaccgctgcgtcgggctcaacctgaccatctacgaccccgacctcgaccccgac
ggcaccgccggcgcgctgctcgcggacatcgttgtggcggccctcacccaagactga

DBGET integrated database retrieval system