KEGG   Streptomyces niveus: BBN63_11320Help
Entry
BBN63_11320       CDS       T04887                                 

Definition
(GenBank) fructose-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
snw  Streptomyces niveus
Pathway
snw00010  Glycolysis / Gluconeogenesis
snw00030  Pentose phosphate pathway
snw00051  Fructose and mannose metabolism
snw00680  Methane metabolism
snw01100  Metabolic pathways
snw01110  Biosynthesis of secondary metabolites
snw01120  Microbial metabolism in diverse environments
snw01130  Biosynthesis of antibiotics
snw01200  Carbon metabolism
Module
snw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBN63_11320
   00030 Pentose phosphate pathway
    BBN63_11320
   00051 Fructose and mannose metabolism
    BBN63_11320
  09102 Energy metabolism
   00680 Methane metabolism
    BBN63_11320
Enzymes [BR:snw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BBN63_11320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX KH_1
Motif
Other DBs
NCBI-ProteinID: AQU66747
UniProt: A0A1U9QRC4
Position
2695058..2696089
Genome map
AA seq 343 aa AA seqDB search
MTEHQLPSPLEVSPEAPDRNLALELVRVTEAAAMAAGRWVGRGDKIGADGAAVNAMRTLV
STVSMNGVVVIGEGEKDEAPMLFNGERVGDGTGAEVDIAVDPIDGTTLNAKGMPNAIAVL
AAADRGAMFDPSAVFYMDKLVTGPEAADFVDINAPVSVNIRRVAKAKRSSPQDVTVVILD
RPRHDDIVKEIRETGARIKFISDGDVAGSIMAVREGTGVDLLMGIGGTPEGIISACAIKC
LGGTIQGKLWPKDAAERQRALDAGHDLDRVLSTDDLVSGDNVFFVATGITDGELLRGVRY
RSETATTQSMVTRSKSGTIRQIDSTHRLSKLRAYSTIDFDRAK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcatcagctcccgtccccgctggaggtctctcccgaggcccccgaccgcaac
ctcgcactcgaactcgtacgggtcaccgaggccgccgccatggcggccggacgctgggtc
ggacgcggcgacaagatcggcgcggacggcgcggccgtgaacgccatgcgcaccctcgtc
tccaccgtctcgatgaacggcgtcgtcgtcatcggcgagggcgagaaggacgaagccccg
atgctgttcaacggagagcgggtcggcgacggcaccggcgccgaggtcgacatcgccgtg
gacccgatcgacggcacgaccctcaacgccaagggcatgcccaacgccatcgccgtgctc
gcggcggccgaccgcggcgccatgttcgacccgtcggcggtcttctacatggacaagctg
gtgaccgggcccgaggccgccgacttcgtcgacatcaacgcccccgtctcggtcaacatc
cgccgcgtcgccaaggcgaagcgctcgtccccgcaggacgtcacggtcgtcatcctcgac
cgcccccgccacgacgacatcgtcaaggagatccgcgagacgggcgcgcggatcaagttc
atctcggacggggacgtggccggctcgatcatggccgtacgcgagggcacgggcgtcgac
ctgctgatgggcatcggcggcacccccgagggcatcatctcggcgtgcgcgatcaagtgc
ctcggcgggaccatccagggcaagctctggccgaaggacgccgccgagcggcagcgggcg
ctcgacgccgggcacgatctggaccgggtgctgtcgacggacgacctggtcagcggcgac
aacgtgttcttcgtcgcgacgggcatcacggacggcgagctgctgcgcggggtgcggtac
cgctcggagaccgcgaccacccagtcgatggtgacgcgttcgaagtcgggcacgatccgg
cagatcgactcgacgcaccggctgtcgaaactgcgcgcctacagcacgatcgacttcgac
cgcgcgaagtag

DBGET integrated database retrieval system