KEGG   Streptomyces niveus: BBN63_16275Help
Entry
BBN63_16275       CDS       T04887                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
snw  Streptomyces niveus
Pathway
snw00450  Selenocompound metabolism
snw00970  Aminoacyl-tRNA biosynthesis
snw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BBN63_16275
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBN63_16275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:snw01007]
    BBN63_16275
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snw03016]
    BBN63_16275
Enzymes [BR:snw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BBN63_16275
Amino acid related enzymes [BR:snw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BBN63_16275
Transfer RNA biogenesis [BR:snw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBN63_16275
 Prokaryotic type
   Other AARSs
    BBN63_16275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AQU67565
UniProt: A0A1U9QV80
Position
3809380..3810993
Genome map
AA seq 537 aa AA seqDB search
MAATGSEEQGGRAYYVTTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDE
HGQKIMRTAEANGVTPQEWADKLVDEAWRPLWDHLNIKNDDFIRTTEKRHTDRVQEFVQD
LFDKDEIYKGGYEGPYCVGCEEYKLPGELLDGEGEFADLKICAIHKTPVEILKEENYFFK
LSEYGPKLLAHYEANPGFIQPESARNEVVNFVKQGLQDLSISRSTFDWGVPVPWDEKHVI
YVWIDALLNYATAVGYNENPAKFEETFPADVHLVGKDILRFHAIIWPAMLLAQGLPLPGK
IAANGWLMVGGEKMSKSNLTGIKPQDLTSHFGVDAYRWYFLRAISFGQDGSFSWEDFSAR
YTSELANDYGNLASRVAAMVGKYYGGTLPETTSGGVAEQAVRDGLAKAVTEADRKIGEEL
DFQGGILAIFDFVKQVNGYITEQEPWKVAKDTSPDGQAALATILYTAAEALRGVAVLLNP
VMPETSQKLWDSLGADAALGALADQRIQDAGTWGLLPAGTTVTKGAVLFPRLEEKPA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggccgccactggatccgaagagcagggtgggcgggcgtactacgtcaccacccccatt
tactacgtcaacgacgctcctcacctgggccacgcctacacgaccgtcgcaggcgacgtc
ctcacccgctggcaccgccagcggggcgagaaggtgtggtacctcaccggcacggacgag
cacggtcagaagatcatgcgcacggccgaggcgaacggcgtcaccccacaggagtgggcg
gacaagctcgtcgacgaggcgtggcggcctctctgggaccacctgaacatcaaaaacgac
gatttcatccgcacgacggagaagcggcacaccgaccgcgtccaggagttcgtgcaggat
ctgttcgacaaggacgagatctacaagggcggctacgagggcccgtactgcgtgggctgc
gaggagtacaagctcccgggcgaactgctcgacggcgaaggtgagttcgcggatctgaag
atctgcgcgatccacaagacgccggtggagatcctcaaggaggagaactacttcttcaag
ctcagcgagtacggccccaagctcctcgcgcactacgaggccaaccccggcttcatccag
ccggagtccgcgcgcaacgaggtcgtgaacttcgtcaagcagggcctccaggacctgtcc
atctcccggtcgacgttcgactggggcgtgccggtgccgtgggacgagaagcacgtgatc
tacgtgtggatcgacgcgctcctgaactacgcgacggccgtcggctacaacgagaacccg
gcgaagttcgaggagaccttccccgccgacgtacacctcgtcggcaaggacatcctgcgc
ttccacgcgatcatctggcccgcgatgctgctggcgcaggggctgccgctgcccgggaag
atcgccgcgaacggctggctgatggtcggcggcgagaagatgtccaagtcgaacctgacc
ggcatcaagccgcaggacctgacctcgcacttcggtgtggacgcgtaccgctggtacttc
ctgcgggcgatctcgttcgggcaggacggctcgttctcctgggaggacttctccgcccgg
tacacctccgagctggccaacgactacggcaacctcgcctcgcgcgtggcggcgatggtc
ggcaagtactacggcggcacgctgccggagaccacgtccggcggggtcgccgagcaggcc
gtacgcgacggcctggcgaaggcggtcaccgaggccgaccggaagatcggcgaggagctg
gacttccagggcgggatcctggcgatcttcgacttcgtgaagcaggtcaacggctacatc
acggagcaggagccctggaaggtcgcgaaggacacgtccccggacggccaggcggcactc
gcgacgatcctgtacacggcggcggaggcgctgcgcggggtggcggtgctgctgaacccg
gtgatgcctgagacgtcgcagaagctgtgggactccctgggcgcggacgccgcgctgggc
gcgctggcggaccagcgaatccaggacgcgggcacgtggggcctgctcccggcgggcacg
acggtcacgaagggcgcggtgctgttccctcgcctggaggagaagccggcgtag

DBGET integrated database retrieval system