KEGG   Streptomyces niveus: BBN63_17575Help
Entry
BBN63_17575       CDS       T04887                                 

Definition
(GenBank) Geosmin synthase
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
snw  Streptomyces niveus
Pathway
snw00909  Sesquiterpenoid and triterpenoid biosynthesis
snw01100  Metabolic pathways
snw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    BBN63_17575
Enzymes [BR:snw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     BBN63_17575
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     BBN63_17575
    4.2.3.75  (-)-germacrene D synthase
     BBN63_17575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: AQU67779
UniProt: A0A1U9QUL9
Position
4096871..4099186
Genome map
AA seq 771 aa AA seqDB search
MTQPFELPDFYMPYPARINPRLEEAREHSRTWAREMGMLEGSGIWEQSDLDAHDYALLCA
YTHPDCTGPQLSLVTDWYVWVFFFDDHFLEIFKRTQDREGGKAYLDRLPAFMPMDLADRF
PEPTNPVEAGLADLWRRTVPSMSLDWRARFAESTENLLNESLWELANINAERISNPVEYI
EMRRKVGGAPWSAGLIEYAAGAEVPARIADSRPMRVLRDTFSDGVHLRNDLFSYQREIEE
EGELSNGVLVLETFLKCSTQEAADAVNDLLTSRLHQFENTALTELGPLFVEKGVDPVAAA
GTLAYVKGLQDWQSGGHEWHMRSSRYMNGADAGGGAAAGETAGPLFSLTPVGRGTAASDY
LKSLTSGLPARTRRHSHVPYQRVGPSILPAFEMPFEARLSPHLEASREHSVEWARRMGIL
EAQPGIPGSDIWDEDRIRRVDVPLCAAGIHPDATPEGLDLTSDWLAWGTYGDDFFPVVYG
NTRNLAAAKVCNERLSLFMPIETLDTPPPLSALERGLADLWIRTAGPMDEDSRRAFRTSV
EDMTASWVWELTNQIQNRVPDPVDYIEMRRATFGSNMTMSLCRIGHSDAVPPEIYRSGPM
KSLENAAQDYACLMNDLFSYQKEIEFEGEVHNGVLVVQSFFNCDYPTGVAIVHDLMKGRM
RQFQHVAANELPVLYDDFGLDTEARAVLDGYVRELENWLSGILVWHAGCHRYKEEDLLRD
RAGITRWLPPTLRGPGTSATRIHLPAPASPTPSSSRGPEQEMVVSIASRAQ
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgacacagcccttcgaactgccggatttctacatgccttatccggcgcgtatcaatccc
cgtctggaggaggccagggagcactcccgtacatgggccagggagatggggatgctggag
ggctccggcatctgggagcagagcgatctcgacgcgcacgactacgcgcttctgtgcgcc
tacacccatcccgactgcacagggccgcagttgtcgctggtcaccgactggtatgtgtgg
gtcttcttcttcgacgaccacttcctggagatcttcaagcggacgcaggaccgcgagggc
ggcaaggcgtatctggaccggctcccggcgttcatgccgatggatcttgccgacaggttt
cccgagccgacgaatccggtggaggcgggactcgccgacctctggaggcgcacggtcccc
tcgatgtccctggactggcgggcccggttcgccgagagcacggagaatctgctcaacgaa
tccctctgggagctcgcgaacatcaacgccgagcggatctcgaatcccgtcgagtacatc
gagatgcgccgcaaggtcggcggggcgccgtggtcggcgggactcatcgagtacgcggcg
ggtgcggaggtgccggcccggatcgccgattcccgtccgatgcgggtcctgcgcgacacg
ttctccgacggggtccatctgcggaacgacctcttctcctaccagcgggagatcgaggag
gagggcgagctgagcaacggcgtgctcgtcctggagacgttcctgaaatgctcgacccag
gaggcggccgacgcggtcaacgacctgctgacctcccgcctccaccagttcgagaacacg
gcgctgacggagctgggcccgctcttcgtggagaagggcgtcgaccccgtcgcggcggcc
gggaccctggcgtatgtgaagggcctccaggactggcagtccggcggccacgagtggcac
atgcgctccagccggtacatgaacggcgcggacgcgggcgggggcgcggcggcgggggag
acggcgggcccgctgttctcgctgacgccggtcgggcgcggtacggcggcgtcggactat
ctcaagagcctcaccagcggcctccccgccaggacgcgccgccacagccacgtcccgtac
cagcgggtggggccgtcgatcctgcccgcgttcgagatgccgttcgaggcgaggctcagc
ccgcatctggaggcgtcgcgcgagcacagcgtcgagtgggcgcgccggatgggcatcctt
gaggcgcagcccggtatccccggctcggacatctgggacgaggaccggatccgccgcgtc
gacgtcccgctgtgcgcggccggcatccaccccgacgcgacgcccgaaggcctcgacctg
acctcggactggctggcctgggggacgtacggcgacgacttcttcccggtcgtctacggc
aacacccgcaatctggcggcggcgaaggtctgcaacgagcggctgtcgctcttcatgccg
atcgagacgctcgacaccccgccaccgctcagcgcgctggagcgcggcctggccgacctg
tggatccgcacggcgggcccgatggacgaggactcccgccgggccttccgtacgtccgtc
gaggacatgacggcgagctgggtctgggagctgaccaaccagatccagaaccgcgtcccg
gaccccgtcgactacatcgagatgcgccgcgcgaccttcggctccaacatgacgatgagc
ctgtgccgtatcggccacagcgacgccgtgccgccggagatctaccgcagcggcccgatg
aagtccctggagaacgcggcgcaggactacgcctgcctgatgaacgacctcttctcctac
cagaaggagatcgagttcgagggcgaggtccacaacggcgtcctcgtcgtgcagtccttc
ttcaactgcgactacccgacgggcgtcgccatcgtccatgacctgatgaagggccgcatg
cgccagttccagcatgtcgcggccaacgaactccccgtcctgtacgacgacttcggcctc
gacaccgaggcgcgcgcggtcctcgacggttatgtgagggagctggagaactggctgtcc
ggcatcctcgtctggcacgccggctgccaccgctacaaggaggaggacctgctccgcgac
cgcgcgggcatcacccgctggctccccccgaccctcaggggccccggcacatcggcgaca
agaatccacctcccggcgccggcatctccgacgccgtcgagcagccgtggcccggagcag
gaaatggttgtctcaattgcctcaagagcgcagtga

DBGET integrated database retrieval system