KEGG   Streptomyces niveus: BBN63_30710Help
Entry
BBN63_30710       CDS       T04887                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
snw  Streptomyces niveus
Pathway
snw00480  Glutathione metabolism
snw00590  Arachidonic acid metabolism
snw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BBN63_30710
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBN63_30710
Enzymes [BR:snw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BBN63_30710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AQU69909
UniProt: A0A1U9R0N8
Position
complement(7148011..7148499)
Genome map
AA seq 162 aa AA seqDB search
MTLYDIPLRTLTGEPTSLAAYKGRAVLVVNVASKCGLTPQYEGLERLQQTYGDRGLTVVG
VPCNQFAGQEPGSAEEIETFCSTTYGVSFPLLEKSEVNGENRHPLYTALTARADAAGEAG
DVQWNFEKFLISPDGEVVDRIRPRTDPEAPEVIAAIEAQLPA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactctgtacgacatcccgctgcgcaccctcaccggtgagcccacgtccctggccgcg
tacaagggccgggcggtgctggtggtgaacgtcgcgtcgaagtgcggcctcaccccgcag
tacgagggcctggagcggctccagcagacgtacggcgaccgcggtctcacggtcgtcggt
gtgccctgcaaccagttcgcgggccaggagccgggtagcgccgaggagatcgagacgttc
tgctcgacgacgtacggcgtgagtttcccgctgctggagaagtccgaggtcaacggcgag
aaccggcatccgctgtacacggcgctgaccgcgcgggcggacgccgcgggcgaggccggc
gatgtgcagtggaacttcgagaagttcctgatctcccccgacggcgaggtcgtggaccgt
atccggccccggacggatccggaggcccccgaggtcatcgcggcgatcgaggcgcaactg
cccgcgtag

DBGET integrated database retrieval system