KEGG   Streptococcus pneumoniae OXC141 (serotype 3): SPNOXC05520Help
Entry
SPNOXC05520       CDS       T02074                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
snx  Streptococcus pneumoniae OXC141 (serotype 3)
Pathway
snx00010  Glycolysis / Gluconeogenesis
snx00030  Pentose phosphate pathway
snx00051  Fructose and mannose metabolism
snx00680  Methane metabolism
snx01100  Metabolic pathways
snx01110  Biosynthesis of secondary metabolites
snx01120  Microbial metabolism in diverse environments
snx01130  Biosynthesis of antibiotics
snx01200  Carbon metabolism
snx01230  Biosynthesis of amino acids
Module
snx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:snx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNOXC05520 (fba)
   00030 Pentose phosphate pathway
    SPNOXC05520 (fba)
   00051 Fructose and mannose metabolism
    SPNOXC05520 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    SPNOXC05520 (fba)
Enzymes [BR:snx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SPNOXC05520 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: CBW32211
Position
550059..550940
Genome map
AA seq 293 aa AA seqDB search
MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPVLIQTSMGAAKYMGGY
KVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIMFDGSHLPVEENLKLAK
EVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMVETGIDFLAAGIGNIHGP
YPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAIKLGVAKVNVNTECQIAFA
NATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVEERIDVFGSEGKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtttcagcagaaaaatttgtccaagcagcccgtgacaacggttatgcagtt
ggtggatttaacacaaacaaccttgagtggactcaagctatcttgcgcgcagcagaagct
aaaaaagctccagttttgatccaaacttcaatgggtgctgctaaatacatgggtggttac
aaagttgctcgcaacttgatcgctaaccttgttgaatcaatgggtatcactgtaccagta
gctatccaccttgaccacggtcactacgaagatgcacttgagtgtatcgaagttggttat
acttcaatcatgtttgacggttcacaccttccagttgaagaaaaccttaaattggctaaa
gaagttgttgaaaaagcacacgctaaaggtatctcagtagaagctgaagttggtactatc
ggtggtgaagaagacggaatcatcggtaaaggtgaattggctccaatcgaagacgctaaa
gcaatggttgaaactggtatcgacttcttggcagctggtatcggtaacatccacggccct
tacccagtaaactgggaaggtcttgaccttgaccacttgcaaaaattgacagaagctctt
ccaggattcccaatcgtattgcacggtggatcaggtattcctgatgagcaaatccaagca
gctatcaaacttggtgttgccaaagttaacgttaacacagaatgccaaatcgcattcgct
aacgcaactcgtaaatttgctcgtgactacgaagcaaacgaagcagaatacgacaagaaa
aaactcttcgacccacgtaaattcttggctgacggtgtaaaagctatccaagcatcggtt
gaagaacgtatcgacgtattcggttcagaaggtaaagcataa

DBGET integrated database retrieval system