KEGG   Streptomyces nigra: DC008_09800Help
Entry
DC008_09800       CDS       T05839                                 

Definition
(GenBank) bifunctional RNase H/acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
snz  Streptomyces nigra
Pathway
snz00860  Porphyrin and chlorophyll metabolism
snz01100  Metabolic pathways
snz03030  DNA replication
Module
snz_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:snz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DC008_09800
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DC008_09800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:snz03032]
    DC008_09800
Enzymes [BR:snz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     DC008_09800
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     DC008_09800
DNA replication proteins [BR:snz03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     DC008_09800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: AWE49991
UniProt: A0A2S1IBH7
Position
complement(2114072..2115283)
Genome map
AA seq 403 aa AA seqDB search
MREFIVEADGGSRGNPGPAGYGAVVIDAATGETLAERAEYIGVATNNVAEYRGLVAGLRA
AHELDPTATVHVRMDSKLVIEQMSGRWKIKHPDMKPLAFEAARVFPPAQVTYEWIPREQN
KHADRLANEAMDAGKRGERWSAADSTAELEAADAKAAGAAGGHAPTAAGGTRTTAPEGAG
TTAAAPSSGWAPADMGAPATFVLLRHGETPLTPHKRFSGSGGTDPALSAAGREQAERVGA
ALARRGTVRAIVSSPLARTRETAGIVAARLGLDVTVEEGLRETDFGAWEGLTFGEVRERH
PDDLTAWLADPEARPTGGGESFAATAERVAAARDRLIAAYAGRTVLLVTHVTPIKTLVRL
ALGAPPESLFRMELSAASLSAIAYYADGNASVRLFNDTSHLRG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggagttcatcgtcgaggccgacggcgggtcgcggggcaacccggggcccgcgggc
tacggcgcggtcgtgatcgacgcggcgacgggggagacgctggccgagcgggccgagtac
atcggcgtcgccaccaacaacgtcgccgagtaccggggcctggtcgccgggctgcgcgcc
gcgcacgagctggacccgacggccacggtccacgtccgcatggactccaagctcgtcatc
gagcagatgtcgggccgctggaagatcaagcacccggacatgaagccgctggcgttcgag
gcggcgcgggtctttccgcccgcgcaggtgacgtacgagtggatcccgcgcgagcagaac
aagcacgcggaccggctcgccaacgaggcgatggacgcggggaagcgcggggaacggtgg
agcgcggcggactccacggcggagctggaggcggccgacgcgaaggccgccggcgccgcc
ggcggtcacgctcccacggcggctgggggcacccgtacgaccgcgcccgagggcgccggt
acgaccgccgccgccccctcgtccggctgggcccccgccgacatgggcgcgcccgccacc
ttcgtgctgctgcggcacggagagacgccgctcaccccgcataagcggttctccggcagc
ggcggcaccgacccggcgctgtccgccgccggccgggagcaggccgagcgcgtgggtgcc
gccctcgcccggcgcggcaccgtccgggcgatcgtgtcctcgccgctcgcccgcacccgg
gagaccgccgggatcgtcgccgcccgcctcggcctggacgtcaccgtcgaggagggcctg
cgcgagaccgacttcggcgcctgggagggcctcaccttcggcgaggtccgcgagcggcac
cccgacgacctgaccgcctggctggccgaccccgaggcccgcccgaccggtggcggtgag
agcttcgcggcgacggcggaacgggtcgcagccgcccgcgacaggctgatcgcggcgtac
gcgggccgtacggtcctgctcgtcacgcacgtcacgccgatcaagacgctggtgcgcctg
gccctgggcgcgccgccggagtccctgttccgtatggagctgtcggcggcctcgctgtcc
gcgatcgcgtactacgcggacggcaacgcgagcgtgcggctcttcaacgacacctcacac
ctgcgcggctga

DBGET integrated database retrieval system