KEGG   Streptomyces nigra: DC008_28705Help
Entry
DC008_28705       CDS       T05839                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
snz  Streptomyces nigra
Pathway
snz00790  Folate biosynthesis
snz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DC008_28705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:snz04147]
    DC008_28705
Enzymes [BR:snz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     DC008_28705
Exosome [BR:snz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DC008_28705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a PD40
Motif
Other DBs
NCBI-ProteinID: AWE53275
UniProt: A0A2S1IL12
Position
6226238..6226540
Genome map
AA seq 100 aa AA seqDB search
MAVEPLSQKEIEDRLSELPGWSPDGDRIARSYRLASHFAATAMVVHIAQVQEELDHHSDL
TLGYNTVSLTVNTHTVGGVTEKDFALARRIEALAPVHGAQ
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaccgctgtcgcagaaggagatcgaggaccgcctctccgagctgcccggc
tggtccccggacggcgaccgcatcgcccggtcctaccggctggcctcgcacttcgcggcc
accgcgatggtcgtgcacatcgcccaggtccaggaggagctcgaccaccactccgacctc
accctcggctacaacacggtgtcgctcaccgtgaacacccacaccgtgggcggggtgacc
gagaaggacttcgcgctcgcccggcggatcgaggccctggcccccgtccacggcgcgcag
tga

DBGET integrated database retrieval system