KEGG   Solibacillus sp. R5-41: CSE16_06510Help
Entry
CSE16_06510       CDS       T05144                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sob  Solibacillus sp. R5-41
Pathway
sob00670  One carbon pool by folate
sob01100  Metabolic pathways
sob01120  Microbial metabolism in diverse environments
sob01200  Carbon metabolism
Module
sob_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sob00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CSE16_06510
Enzymes [BR:sob01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CSE16_06510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA ParA
Motif
Other DBs
NCBI-ProteinID: ATP39730
UniProt: A0A2D1SRJ2
Position
1397249..1398928
Genome map
AA seq 559 aa AA seqDB search
MTTTITKPLTDLDIANNAIMKPITEIAENAGIPVESIEQYGRYKAKIDVNKISGQANAKV
VLVTAISPTPAGEGKSTVTVGLADALKQLDQRVMIALREPSLGPVMGVKGGATGGGYAQV
LPMEQINLHFNGDFHAITTANNALSAFIDNHLHQGNALNIDPRRITWKRVVDLNDRALRH
VTVGLGGPMQGVPREDGFDITVASEIMAIFCLATSLTDLKARLANIVIGYTYDRQPVTVR
DLGVEGALTLILKEAINPNLVQTIEGTPALIHGGPFANIAHGCNSIIATQTARKLADIVI
TEAGFGSDLGAEKFMHIKAREAGFAPSAVVIVATIRALKMHGGVAKTALIDENVDALQQG
IYNLAQHVKNIRNFGVEPVVALNRFISDSEAEVNTVLNWAKQEGVRIALTNVWEEGGKGG
LELAKQVLEVIENPNNFHYLYENNESVEQKLTKIVQQVYGGKGVQFTDVAKKQLVSIENN
GWANLPICMAKTQYSLSDQPSLLGRPTDFTVTIREILPKLGAGFLVCLTGDIMTMPGLPK
QPAALRMDVAEDGSALGLF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacaactacgataacaaaacctcttacagatttggatattgcgaataatgcaataatg
aaaccgattaccgaaattgcagaaaatgcgggaatacctgtagaatctatcgagcaatac
ggacgttataaagcaaaaattgatgtgaataaaatttctggccaagcaaatgccaaagtc
gttttagtgacagcgattagtccaacaccagctggggaaggtaaatcaactgttaccgtt
ggattagcggatgcacttaagcaattggatcaacgtgtcatgattgcgctacgtgaacct
tcattaggtcctgtcatgggtgtaaaaggtggggcaacaggtggaggttatgcacaagtt
ctcccaatggagcaaataaatttacattttaatggagatttccacgcaattacgacggca
aataatgcattatcggcatttatcgacaatcaccttcatcaagggaatgctttaaatatc
gaccctcgccgaattacttggaagcgtgtcgttgatttaaatgaccgtgcgttacgtcat
gttacagtgggcttaggtggtccaatgcagggtgtaccacgtgaagatggatttgatatt
acggtagcgtcagaaattatggcgattttctgtttagcaacaagtttaacggatctaaaa
gcacgtcttgcaaacattgtcattggctacacatatgatcgtcagcctgtcactgtacgt
gatttgggtgttgaaggtgcgcttacattaatcttaaaagaagcgataaatccaaatctt
gtgcaaactattgaaggaacaccagcattaatccatggtggtccatttgcaaatattgca
cacggttgtaactctattattgccacacaaacagcccgtaaactggcagacattgtcatt
actgaagctggatttggatcggatttaggtgcagagaaatttatgcatattaaagcgcgt
gaagcaggttttgcaccaagtgcggtagtaatagttgcaacaattcgtgcgttaaaaatg
catggtggtgttgcgaaaacagcgttaattgatgaaaacgtagatgcgcttcaacaaggt
atttacaatcttgcgcagcacgtaaaaaatattcgcaattttggtgttgaaccagttgtc
gctctaaatcgttttatttcagattcagaagccgaagtaaatacagttttaaattgggca
aaacaagaaggcgttcgtatcgcgcttacaaatgtttgggaagaaggcggaaaaggtgga
ttggaactggcaaagcaagtgctagaagtaattgaaaatccaaataacttccattatttg
tacgaaaacaatgaatccgttgaacaaaaactgacgaaaattgtacaacaagtgtacggt
ggaaaaggtgttcaatttacagacgtagctaaaaaacaattagtgagcatcgaaaataac
ggatgggcgaacttgccgatttgtatggcaaaaacgcaatattcattatcagaccaacca
agcttacttggcagaccgactgactttaccgttacaatccgtgagattcttccgaaacta
ggagcaggtttcctagtttgccttacaggcgatattatgacgatgccaggcttaccaaag
caaccagcagcactacgcatggacgtagcagaagatggcagcgcactaggcttattttaa

DBGET integrated database retrieval system