KEGG   Solenopsis invicta (red fire ant): 105193641Help
Entry
105193641         CDS       T03916                                 

Definition
(RefSeq) uncharacterized protein LOC105193641
  KO
K12567  titin [EC:2.7.11.1]
Organism
soc  Solenopsis invicta (red fire ant)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soc01001]
    105193641
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:soc04131]
    105193641
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:soc04812]
    105193641
   04147 Exosome [BR:soc04147]
    105193641
Enzymes [BR:soc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105193641
Protein kinases [BR:soc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105193641
Membrane trafficking [BR:soc04131]
 Others
  Actin-binding proteins
   Others
    105193641
Cytoskeleton proteins [BR:soc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105193641
Exosome [BR:soc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105193641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 Receptor_2B4 Y_Y_Y
Motif
Other DBs
NCBI-GeneID: 105193641
NCBI-ProteinID: XP_025994691
Position
Unknown
AA seq 1414 aa AA seqDB search
MGNATTKDYSRSISIGNSSKKTRWDGPGLPAPPGKPILISGTNETQPDVVAIRWERSPSN
GGSAIIGYLVEHRRLGSPHWVRSTSGLCAFPELTLSGLEPGWRYQFRIKAQNALGLSQPS
EVSEPLTVTLQRATIACAPQFDLELKDKVALENEQAEFIIQFSGTPLPKISWFKDGFEIF
SSRRTRIITDNGKSTLLIHQTTLNDEGEIKCTATNRAGHVATRAKLILEAPPRIRLPRQY
EDGLLFEQDETIRLKVSLAGKPAPIVTWFHDGELISKDTRHVFEMMDGESVLKIPDAKRS
DRGEYTVKVTNKLGEDTTSFLVTVTDRPAAPGKISVAMTLGRSVTLSWEEPEDDGGCKIG
TYIIEYYRIGWEVWLKAATSRRTTATLTELIEGSEYKFRVKAENPYGVSEPSEESDIIFI
PDIKRSVTAQSLTEKSQSHREISRSRGDKREMGFTMPAQRTRSLTREEAKTRNDENNGRF
GHDERSASMQRLAMPITTLDRPSRADSRVTFAPDTLEKDQPPIPPTRSREHNSTKQQVIF
GNHTNQLNIAARNKQNIITNQERTMTAKTAAIEPISSSVIEENTTSRLVAREKSLSPLCV
PKIQEYPKEESCSTTNHHFLSSSKLIPKKQTAIVNEAMLFPSDNSQSQRILQEDDENALH
GSSEFMLVLYPEDETQKEDVINMNNSAECQIKNSINRNVIESIEDENDLIPPPMSSSLPE
LFSTQHQVVEIMREAVSSTELLHERAMERFYRAVAAEEASEIAKQKMQFETQTELMLLDV
ESIKKPSLRRRLSNSGVTQNLIASWQAKKNRRRSSEGQTNVSPKTLKLLSPILLPDVEAR
SDPNLPSEMIIIDPWEKSNKIETAERLRRWHETNVPLLEQVQQKNSIQTNNEDKVIITPS
ITVNKVESQPLIQTKSEEEETNIIETSEESSEENSSTDSEDLKLLKSRILARQIVNEEDT
YHPKGRPVPHADSELIQIPYDRLSTFEISSLSSVQTTTSVSPNNVMPKSILKKPKEEMNF
QDNFGKSIPPEKPIRKSLSQSYQQEDIEKISTDNNDRIPNFFNMSEETLKTPTLISESDT
DSIISAAEAAKNRRMQSKWRSITPEEEAAEIEARMAVVNQYTEIVREHACLSRHGSAASS
RRSSISEDQDQKHRIQEKLVPKLIDKQEQDETIKSKIKNKIEIDQQKLNNQTPSFRRKSV
DSRDIISAEDMMTNKEKRRSRPSSRDQSPTVRRSKRIESASSRSSSKTRNRTPSQERNNL
SLAKNDLNEQGSRRSKVSSRPSSRSSSRSSSRERFGATVPVESKVDKLQKALDSSKYRAI
KKEIKVTKISKENSGENTPDQTNEKQLALEAKRTVRSTVSYITDLTLLIAAMYIYFFKKE
TLAVPFIVLLLYRKVQEEIHKWMPRRWRRSTKKH
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgccaccacgaaagattactcaaggagcatctccattggcaacagctcgaag
aaaacgcgttgggatggtccaggtctgccggccccaccgggcaaacctatcctaatatcg
ggaacaaatgaaacgcagccggatgttgtggcaatacgatgggagagatcaccaagtaac
ggtggatcggcaattattggatacttggttgaacatcgacggctgggctctcctcactgg
gtacgaagcacctccggtctttgcgcctttccagaactaaccttgagcggtctcgaacca
ggatggcgttaccaatttcgaatcaaagcgcaaaatgcactcggactttcacaaccaagc
gaagtctccgaaccactcacagtcactttacaaagggccactatcgcctgcgctccacaa
tttgatttggagcttaaagataaggttgcgctcgagaacgaacaggccgagtttattata
caattctctggaacaccattgccaaaaatttcgtggttcaaagacggtttcgaaattttt
agtagtagacgcacaagaatcattactgataatggaaaaagtactctcttgattcaccag
accacgcttaacgacgagggtgagattaaatgtaccgccacgaaccgagcaggtcatgtt
gctacaagagctaagttaattctcgaagcacctccacgaatacgactgccacgtcaatat
gaagatggtttgctttttgaacaagacgagaccattagactgaaagtatctttagcgggt
aagccagcgcctattgtcacctggtttcacgatggagagttaatatccaaagatactaga
catgtgtttgaaatgatggatggtgaatcggttctaaaaataccagatgcgaaacgaagt
gatcgaggagaatatactgttaaagtcacaaataaactgggcgaagatactacgtctttc
ttggttactgtgacagatcgacccgctgctcctggcaaaatatctgttgcaatgacacta
ggtagatcggtgacgttatcgtgggaggaaccagaagatgacggcggatgtaaaatcgga
acgtatattatcgaatattacagaattggctgggaggtatggcttaaagcagcaacaagt
agacgtaccactgcaacattaacagaactgatcgaaggttctgaatacaaatttcgcgta
aaggctgaaaatccttatggagtcagtgaacctagcgaagaaagcgatattatttttatt
ccagatattaaacggagcgtaacagcacaatctttgaccgaaaagtcacaaagtcatcga
gagatcagcagatcgcgtggcgataaacgagagatgggttttactatgcctgcacaaaga
actagaagtttaacgagagaagaagctaaaacacgaaacgacgaaaataatggtcgcttt
ggacatgatgagcgatcagcttcaatgcaacgacttgcaatgccaattacaacattggat
agaccatccagagcagatagtagagtaacctttgcaccagatactttggagaaagatcaa
cctccaattcctccaactagatcaagagaacataattccacaaaacaacaagttattttt
ggaaatcacacaaatcaattaaatattgcggcaagaaacaagcaaaatattattacaaac
caagaaagaacgatgactgcaaaaacagcagcaattgaaccaatctcttcttcagttatt
gaagaaaatactacgtcacgtcttgtagcaagagaaaagagtctgtctccactttgtgta
ccaaaaattcaagaatacccaaaagaggagagttgtagtacaacaaatcatcatttttta
tcatcttcaaaattaattccgaaaaagcagactgccattgtaaatgaagcaatgttattc
ccatcggacaattcacaatcacaaagaatactacaagaagatgacgagaacgcattgcac
ggtagttcggaatttatgctggttctatatccagaagatgaaacacaaaaggaagatgta
atcaacatgaacaattctgcagaatgtcaaataaaaaacagcataaatagaaatgtgatc
gagtcaatagaagatgagaacgatcttataccaccaccaatgtcatcatctcttccagaa
ttatttagtacgcagcaccaagtagtggaaataatgcgagaagcagttagttccaccgaa
cttcttcacgaacgagctatggaacgtttctatcgcgcagttgctgctgaagaggcgtcc
gaaattgctaaacaaaaaatgcaatttgaaacacaaactgaattaatgttattagatgtc
gaatctattaaaaaaccatcacttcgaagacgtctatctaattccggtgttacacaaaat
ttaattgcttcctggcaggccaagaaaaatcgtcgaagatcaagtgaaggacaaacaaat
gtatctccaaaaacgttgaaacttctttctccaattttattaccagatgtcgaagccaga
tcagatccaaaccttccctctgaaatgataataatagatccctgggaaaagagcaacaag
atcgaaactgcggagcgtctgcgtagatggcacgaaacgaatgtaccattactagaacag
gtacaacaaaagaactcgatacaaacaaataatgaagacaaagtgataattacaccatct
atcacagtgaataaagtagaatctcaaccgttgattcaaacaaaatcagaagaggaggag
actaatattattgaaacttccgaagagtcatcagaagaaaacagtagtacagacagtgag
gatttaaaattattaaaatcaagaattctggcaagacaaattgtcaatgaagaagatact
tatcatcctaaagggagaccagtcccacatgctgactcagaattaatacagattccatat
gacagattatcaacttttgagatttcgtctctttcatctgtccaaacgactacatccgtc
tcacccaataatgtgatgcctaaatcaattttaaagaaacctaaagaagagatgaatttt
caggacaattttggtaaatctattcctccagaaaaaccaattagaaaatcattatcgcaa
tcataccaacaagaagatatagagaaaataagtacggataacaacgacagaattccgaat
ttctttaacatgtccgaagaaactctaaaaactcctactcttatatcggaatcagataca
gatagtattatatctgcagcagaagcagcaaaaaatcgaagaatgcaatcaaaatggcga
tctataacacccgaagaagaggcagccgaaatagaggctagaatggctgttgtaaatcaa
tacactgaaatagttcgggaacatgcgtgcctctcacgacatggtagtgcagctagttct
cgcagatcatctatttccgaagatcaagatcaaaagcaccgaatacaagaaaaacttgtg
ccaaagttaatagataaacaagagcaggatgagacaataaaatcaaaaattaaaaataag
attgaaatcgaccaacaaaagttaaataatcaaacgcccagtttcagaagaaaaagcgtt
gattccagggatataatttcagcggaagacatgatgactaacaaggaaaagcgtagaagt
agaccaagttctagggaccaatctccaactgtaagaaggagtaaaagaatagaaagtgct
tcttcgagatcatcttcaaaaacccggaatcgcacgccttcgcaggaaagaaataatcta
tccttagcgaaaaatgatttaaatgagcaaggctctcgtagatctaaagtatcttctaga
ccttcatcgcgctcttcatctagatcaagttctagagaaagatttggagcgacagtacca
gtagaatcaaaggttgataaattacaaaaagcactcgatagtagcaagtatcgagcaata
aaaaaagaaatcaaagtaaccaaaatcagtaaagaaaattctggagaaaacactcctgat
caaacaaatgaaaaacagttagctctagaggctaaaagaacagttagatcaacggtgagc
tatataaccgatctgactttgctaatagctgcaatgtatatttatttctttaaaaaagaa
actttggcggtcccatttatcgtgcttctcctatatcgaaaagtacaagaagaaatacat
aaatggatgccacgtcgttggagacgatctaccaagaaacattaa

DBGET integrated database retrieval system