KEGG   Solenopsis invicta (red fire ant): 105193878Help
Entry
105193878         CDS       T03916                                 

Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc04136  Autophagy - other
soc04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:soc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105193878
   04136 Autophagy - other
    105193878
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:soc04131]
    105193878
   03029 Mitochondrial biogenesis [BR:soc03029]
    105193878
Membrane trafficking [BR:soc04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    105193878
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    105193878
Mitochondrial biogenesis [BR:soc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    105193878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Cytochrom_D1 Cluap1 Nup160 DUF4407 FAM184
Motif
Other DBs
NCBI-GeneID: 105193878
NCBI-ProteinID: XP_011156839
Position
Unknown
AA seq 568 aa AA seqDB search
MISNEAGVSLGVTREDVNWRKDLISQLRERNRSQTNCFADLISLHNRLFENTNTLRNTNM
QLTIANETLRREAANGSIGMGGNPDLEARLLKQAEELAMLHKRKGEHTQQIVDLNNKLQE
MTKEFQAKETSLAESLEANTNLRLEITKCFGREKELEGINQMLKDEHQALQLAFASLEEK
LRKTQEENRQLIERLIKYKARDAEKMNEENDNFLSFTSPTAFLMHTLSKFGKRQAKMQKE
LEDAARDTRPVSPDRLSLKEVAGLPTAVPTKVSVTFSAHEGEVCAVKWSPTDRILATGGA
DRKVKLWNITKGTSESKGILVGSNAGVMSVDFDSTGTLILGASNDYASRVWTVNDLRLKH
TLTGHCAKVMAAKFLGEPSKVVTGSYDRTLKIWDLRSKACIETKFAGSSCNDLVTSDGAG
STIISGHFDQRIRFWDTRAESSSNDILLEGKVTSLDLSRDANYLLSCVRDDTVKLIDLRM
KKIVGSFSADGFKVGFDWTRAAFSPDGQYIAVGSADGSVFIWSIATNMIETILKGHMAAV
TAVSWHPHGTYLASVDRAKTVIIWGDQV
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgaacgaagcaggcgtttcgctcggcgttacccgggaagacgtcaactggcgg
aaagatttaatctcacagctacgtgaaagaaacagatcacaaaccaattgtttcgcagat
ctcatcagcctacacaataggttatttgaaaatacaaacacattgcgaaatacaaatatg
caattgacaattgcaaatgagactctccgtcgggaagcagccaatggcagcattggcatg
ggtggaaatcctgatcttgaagctagactcttaaagcaagcggaagaattggcgatgctg
cataagaggaaaggagaacatacacaacaaatagtagatctcaataataaattgcaggaa
atgacaaaagaatttcaagcaaaggaaactagccttgcagaaagtttagaagccaatact
aacttacgtttagaaataactaaatgctttggtagagagaaagagttagaaggtattaat
cagatgctcaaggatgaacaccaagccttgcaacttgcttttgcatctttagaagaaaag
cttaggaaaacacaggaagaaaatcgacagctgattgaacgtttgataaaatataaagcc
agagatgcagaaaagatgaatgaagaaaatgataactttttaagttttacgagcccaaca
gcctttttgatgcataccttatcaaaatttgggaaaagacaagcaaagatgcaaaaggaa
ttggaagatgcagctcgagatacgcgacctgttagtcccgatcgtttaagcttaaaagaa
gtcgctggtcttccgacagcagtgccaaccaaagtatccgtaacatttagtgcccatgag
ggggaagtatgcgctgttaaatggtcgcctactgatagaatattggctactggaggtgct
gataggaaggtgaagctttggaacattactaaaggtacatcggaaagtaagggcatcctc
gttggcagcaacgccggtgtgatgtcggtggacttcgattcgacgggcacccttattctt
ggagcgtccaacgattatgcgagccgcgtctggactgtcaacgatcttcgcctaaagcat
acactcacgggccactgcgcaaaggtgatggcggcgaagtttcttggcgagccgtcgaaa
gtagttacgggaagttatgatcggactttaaaaatctgggatctgcgcagcaaagcatgt
atagaaacgaaatttgctggttctagttgcaatgatcttgtaacttccgatggagcggga
tctacgataattagtggtcattttgatcaaaggatcaggttttgggacactagagccgaa
tccagttcaaatgacattctcttagaaggaaaagttacatctttagatttatcccgagac
gcaaattaccttttgagttgcgtcagggatgacacggtgaaactgattgatttacgaatg
aagaagattgtcggatcgttcagcgctgatggtttcaaagtgggattcgattggacaaga
gctgctttcagtcctgatggacagtacattgcggttggttccgcggacggttccgttttc
atctggtctatagcgacgaatatgatcgaaacaatactaaaagggcacatggcagcagta
acggccgtgtcttggcatccgcacggcacgtatttagcgtctgtcgatcgtgccaagacg
gtgataatttggggcgaccaggtttga

DBGET integrated database retrieval system