KEGG   Solenopsis invicta (red fire ant): 105194175Help
Entry
105194175         CDS       T03916                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00010  Glycolysis / Gluconeogenesis
soc00562  Inositol phosphate metabolism
soc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105194175
   00562 Inositol phosphate metabolism
    105194175
Enzymes [BR:soc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105194175
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105194175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 CRF-BP
Motif
Other DBs
NCBI-GeneID: 105194175
NCBI-ProteinID: XP_025995072
Position
Unknown
AA seq 502 aa AA seqDB search
MWARLWFFISLIWLTQNVVFGIPGSCANYIYPLTNNENTYPYTGTETPYNLVHINTETTM
TIPSETDQFSDCKPMQIWMLNKHGAQYPNEYMLRQIVNFTSKMRHNFLYLMKKIYSGQPM
ESIPLYARIQKNWQTCPEFVNGRARNLSSRGKKDMVSLGERIRAKLATLFNEDVRKSFKF
RSTATEHTATSMLSFINGAFNQGYKLHKPKKFESWNVTQYLTMKSFDGASSDTVLKFEIV
PAIHDTLLKLYANCGTWNNFDNKEVQAFATTEMAKIFDDVFRDLQLPSEYNKNVMATIYN
TCRYERAVCPDKPSPWCDVFTIDEMKALEYQYDLSSYYFVGPGRQINRQLGCHPIRDMLQ
HFTKLERANSDEPRGVFYFAESQMLSLFLTALGVGEDSVPLTAANYRYSGNRSWRISRLV
PSSANFAAVFHRCYSNDNPFKVTFYLNENPLPLEGCENGVCNWTQLKKKLGEIANKCSTR
EDFVIVPNYVRLTNDTFWFQET
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgagattgtggttcttcatttccctgatatggctgacgcaaaacgtggtgttt
ggtattcccggatcctgcgccaattacatttatcctttaacaaacaacgagaacacttat
ccttacacaggcaccgagacaccgtataatctcgttcatataaataccgaaacaaccatg
actataccgagcgaaactgatcaattttcagactgcaaaccgatgcagatatggatgtta
aataaacacggggcgcagtatccgaacgagtacatgctgagacaaatcgtaaacttcacg
agcaaaatgcgccacaacttcctctatttgatgaaaaaaatatactcaggacagccgatg
gagtccatacctttgtacgcaaggattcaaaagaattggcagacttgccctgagtttgtc
aatggcagagcaagaaatttatcatcgcggggtaaaaaggacatggtgtcgctcggcgaa
agaatcagagcgaaattggcaacgcttttcaacgaggacgtgagaaaaagtttcaagttt
agatcaacggctacagaacacactgccaccagcatgttgtctttcataaacggagccttc
aatcaagggtataaattacataaacccaagaagttcgaatcgtggaacgtaacacaatat
ttaaccatgaaatcctttgatggagcttcgagtgatacggtgctcaaatttgaaatagtg
ccggctatccatgacactttgttgaagctgtacgctaattgcgggacttggaacaatttc
gataacaaagaggtacaggcgtttgctaccacggaaatggcgaaaattttcgacgatgtc
tttcgagacttacagctcccaagtgaatataacaaaaatgtgatggctacgatatacaac
acttgtcgctacgagcgagctgtgtgcccggacaaaccgtcgccctggtgcgacgtgttc
accatcgacgagatgaaggccctcgagtaccaatatgatctctcgtcttactatttcgtc
ggtccaggcaggcagatcaaccgccagctcggatgtcatcccatccgggacatgcttcag
cactttacgaaattggagagagcaaatagcgatgagccaagaggcgtgttttacttcgcc
gagtcgcaaatgctatcgctgtttctcaccgcgttgggagttggcgaggactccgtgccg
cttacggccgcgaattatcgatactcgggtaacagaagttggagaatctcccggttggta
ccgtcttccgcgaattttgcggcggtctttcacagatgctactcgaacgataatcccttc
aaagtcaccttctacctaaacgagaatcctttacctctcgaaggctgcgagaacggagtc
tgcaattggacgcagctgaagaagaagttgggtgaaattgcgaacaagtgcagcacgaga
gaagacttcgtgatagtgcccaactatgtgaggcttacaaatgatacattctggtttcaa
gaaacgtga

DBGET integrated database retrieval system