KEGG   Solenopsis invicta (red fire ant): 105194280Help
Entry
105194280         CDS       T03916                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
soc  Solenopsis invicta (red fire ant)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soc01001]
    105194280
Enzymes [BR:soc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105194280
Protein kinases [BR:soc01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   105194280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH Asp-B-Hydro_N
Motif
Other DBs
NCBI-GeneID: 105194280
NCBI-ProteinID: XP_011157435
Position
Unknown
AA seq 481 aa AA seqDB search
MLLSLRRDLAVRKSRATSMPKSATKWRFWRKSRRAVLEEDNQKESKRKRSAPAVVVTQVI
RQDYDQLTEQKVSEQKVSEQKVPKQKVPEQKVPEQKVPEQKVPEQKVPKQKVLEATDIRR
KMDHPLNSRLSPKVTPITDDYEISNHVLGLGINGKVVQCYDKNTRQKYALKVLHDCAKAR
REVELHWRASNCRHIVQVKDVYENSYSGNKCLLVVMECMEGGELFQRIQDRQDGAFTERE
AAQVMYEICVAVKHLHDMNITHRDLKPENLLYSRPDITGILKLTDFGFAKETHLKDTLQT
PCYTPYYVAPEVLGPEKYDKSCDIWSLGVIMYILLCGFPPFYSNHGLAISPGMKKRIRLG
QYDFPSPEWSNVSQEAKNLIKGMLCIDPAERLQIDSVMRNNWIAKYMEVPPTPLHTGRVL
REGEEMWPEVQEEMTRSLATMRVDYDTAALKQLDHTNNPLLNKRRRAKQSANNTTVPTPA
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgtctctccgacgggatttagccgtgcgaaaatcgagagccacatcaatgccg
aagtcggcaactaagtggagattctggagaaagtccaggagggctgttctcgaggaggac
aaccaaaaggagagtaagcgcaagcgctcggcaccggcagtggtcgtaacgcaggtgatc
aggcaggattacgatcagctaaccgaacagaaagtatcggaacaaaaagtatcggaacag
aaagtaccgaaacaaaaagtaccggaacaaaaagtaccggaacaaaaagtaccggaacaa
aaagtaccggaacaaaaagtaccgaaacagaaagtattagaagcaacggacatcaggagg
aagatggatcatccactgaacagtcggctatcgccgaaggtcacgccgatcacggacgac
tacgagatcagcaatcatgtcctgggtcttgggatcaacgggaaggtcgtgcagtgctac
gacaaaaacacgagacagaaatacgctcttaaggtcctacatgattgtgcaaaagcgcga
agagaagtcgagcttcactggagagcatcgaattgtaggcacatagtccaagtcaaggat
gtgtatgaaaattcctacagcgggaacaaatgtctgctagtagtcatggaatgcatggag
ggcggagagttgttccaaaggatacaagacaggcaagacggcgcttttaccgaaagagag
gccgcgcaagtgatgtacgagatctgcgtcgcggtgaagcatctacacgacatgaacatc
actcatagggatctaaaacccgaaaatcttttatattccagacctgacatcactggaatc
ctaaaactcaccgattttggatttgctaaagaaacgcacttgaaagacacattacagacg
ccatgttacacaccttattatgtcgctccggaagttttgggaccagaaaaatatgataag
agctgtgatatttggtcgttgggagtaattatgtatatattattatgcggctttccacca
ttctatagcaaccacggactagcgatctcgcctggaatgaaaaagaggatccgattaggc
caatacgactttcctagtccggaatggtcaaacgtgagccaagaagctaagaaccttatt
aagggtatgctgtgtatagatccagcggaaaggttgcagattgactccgtgatgcgtaac
aactggatcgccaaatatatggaagtaccccccactcctttacacaccggacgcgttcta
cgcgagggagaggaaatgtggcctgaggtacaagaggagatgacgcgatcgctggcgacg
atgcgcgtcgactacgacacggcggctttaaaacagctcgatcacacgaacaatcctcta
ttaaataaacgtagacgcgcgaaacaatccgcgaacaacacgacggtgcccacgcccgcc
tcctag

DBGET integrated database retrieval system