KEGG   Solenopsis invicta (red fire ant): 105194765Help
Entry
105194765         CDS       T03916                                 

Definition
(RefSeq) venom acid phosphatase Acph-1
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
soc  Solenopsis invicta (red fire ant)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105194765
Enzymes [BR:soc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     105194765
    3.1.3.5  5'-nucleotidase
     105194765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105194765
NCBI-ProteinID: XP_011158156
Position
Unknown
AA seq 408 aa AA seqDB search
MFLIQSTIFTVFLGSLAVSVDPDVELQLLHVVLRHGDKVPQREFQNYPNDPHRHHSYYPI
GDGDLTNQGKMREYKIGTMLRERYDQYFGPDYWPAKIYARSTDVPRTQLSLQLVLAGLFP
PSEKQTWNPHLPWIPAWTFFVPYKTDNLLFPHYCYRYIEEYQRFLQLGSGKEMVNKYKNV
LEYLTDHTGKLVNNTGAVAHLYNLLKEEAAQNLTLPRWTQNVFPSPMKDILELDFKLRSY
TKTLKRLNGGMLLRKMVDDVQAHQEGKLIRDRKAFLFGAHEVNVAALAYALGTNEPTVPA
YGATIILETLRDKKGIYYIRVLLWTGVTEQLKVQTIPGCAEMCPFDDFLGIVKDILPSDD
EYYCRNKTESLKINAHHRSSATCIANNVSWRYIFLTVLLAFTSKFVQK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcatacaatcgacaattttcaccgtatttctcggcagcctcgccgtatcggtt
gatcccgacgtagaattacagctgcttcacgtggtacttcgccatggtgacaaagtgccc
caacgagagttccaaaactaccccaatgatccgcatcgccaccactcttactatccgatc
ggcgacggcgacttgaccaatcaaggcaagatgcgggagtacaaaatcgggacgatgctg
cgcgaaagatacgatcaatatttcggaccggattattggccggccaagatctatgcccga
tctacggacgtcccacggacccagctgtctctccagttagttctggcaggattattcccg
ccctccgagaagcaaacctggaatccgcacttgccctggattccggcgtggacgttcttc
gtgccgtacaagactgacaacctcttgtttccgcattactgctatcgatacatagaagaa
tatcaacgattccttcagctaggcagtgggaaagagatggtcaacaagtacaagaatgta
ttggaatacttgacagaccacactggtaaactagttaacaatacgggtgcagttgctcac
ttgtacaatctactgaaagaggaggctgcgcaaaatttgacgctgccaaggtggactcag
aatgtttttccaagtccgatgaaagacatactagagttagacttcaaacttcgatcatac
acaaaaaccttaaagagattaaatggaggcatgctgcttcgcaaaatggtggatgacgtt
caggcacaccaagagggaaaattaatacgtgacaggaaagcttttctatttggcgcccac
gaagttaatgtggctgcccttgcctatgctttaggaacgaatgaaccaacggtaccagct
tatggagccacgatcattcttgagacacttcgcgataaaaagggaatttattacattcgg
gtcttgctatggactggcgttacagaacagctaaaagtacaaacgatcccaggttgcgcg
gaaatgtgtccctttgacgatttccttggcattgtgaaggacattctgccgagtgacgac
gagtactactgtcgaaataaaacggaaagtcttaagataaacgcgcatcatcgatcgtca
gcgacatgtatcgccaacaacgtgtcttggaggtacatttttctcaccgttctccttgcg
ttcacatcaaaattcgtgcaaaagtga

DBGET integrated database retrieval system