KEGG   Solenopsis invicta (red fire ant): 105197233Help
Entry
105197233         CDS       T03916                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00350  Tyrosine metabolism
soc00360  Phenylalanine metabolism
soc00380  Tryptophan metabolism
soc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105197233
   00360 Phenylalanine metabolism
    105197233
   00380 Tryptophan metabolism
    105197233
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:soc04147]
    105197233
Enzymes [BR:soc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     105197233
    4.1.1.105  L-tryptophan decarboxylase
     105197233
Exosome [BR:soc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105197233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105197233
NCBI-ProteinID: XP_011161827
UniProt: E9IRC3
Position
Unknown
AA seq 480 aa AA seqDB search
MDPDSFKEYAKDMAEYITNYLENIRDRRVLPTVEPGYMKPLLPSEAPQSPEQWQDIMADI
ERVIMPGVTHWHSPKFHAYFPTAQSYPAILADMLSGAIACIGFTWIASPACTELEVIVLD
WLGKMLDLPKEFLACSGGRGGGVIQGTASEATLVALLGAKDKKIKQVKEQHPDWTENEII
SKLVAYCSCQAHSSVERAGLLGGVKFRQLEVDEKHKLRGDTFAEAIRKDKEQGLIPFYAV
ATLGTTVNCAFDRLDEMGIVANREDVWLHVDAAYAGSAFICPEFRYLMKGIEMADSFNFN
PHKWMLVNFDCSAMWLKDPTCVINAFNVDPLYLKHDMQGAAPDYRHWQIPLGRRFRSLKL
WFVLRLYGVENLQKFIRSHVAQAHEFEALVLTDPRFEIVGEVIMGLVCFRLKGSNELNEV
LLKRINGAGNIHLVPSKIKDTYFLRFSVCSRFSESKDIQYSWKEIKLRASEVLEEQSLSK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgatagcttcaaggagtacgcgaaggatatggcggaatatatcacaaactat
ttggaaaatattagagacaggagagttttgcctacggtggagccaggatatatgaaaccg
cttttaccgtccgaagcaccgcaatctccagaacagtggcaggatataatggccgatatc
gaaagagtgataatgccaggtgttactcattggcacagtccaaaattccacgcatacttt
cccactgcgcaatcgtatcctgcgattctggccgatatgttaagcggagctattgcgtgc
atcggattcacctggattgcgagtccggcctgtacagaactagaagtaatcgtactggat
tggttaggaaaaatgctggacttgccgaaagaatttctggcctgcagcggtggaagaggc
ggtggcgtcattcagggtactgctagcgaagccactttggtagcgttactaggagcgaag
gacaaaaagataaagcaagttaaagagcagcatcccgattggacggaaaacgagatcatc
agtaaactagtcgcatactgttcttgccaagcacatagttcggttgaacgcgctggactt
cttggtggagtaaaatttagacagttggaagtcgatgaaaaacacaagctgcgcggtgac
acattcgctgaagcaatcaggaaggataaagagcaaggcctcataccattttatgccgtt
gctactttgggtactactgttaattgcgcctttgatcgtctcgatgaaatgggcattgta
gcaaatcgtgaagacgtttggctgcatgtagacgctgcttatgcaggatccgcttttatt
tgcccggaatttagatacttaatgaaaggcatcgaaatggcagattcattcaatttcaat
ccgcataaatggatgttagttaattttgactgctctgccatgtggcttaaggatccgaca
tgcgtcataaacgcttttaatgtcgatcctttgtacctgaaacacgatatgcaaggggca
gcaccggattacaggcactggcagattccacttggacgcagattccgatctctgaaactt
tggtttgtattgagactctacggagttgaaaaccttcaaaagttcatcagatcgcacgtt
gctcaagcacacgaattcgaagcgttagtccttaccgaccctcgcttcgaaattgtaggt
gaagttatcatgggattagtttgcttccgactgaagggatccaacgaactcaacgaagtc
ctgctaaagagaatcaacggtgcaggaaatatccatctcgtcccgtcaaagataaaggac
acgtacttcctgcgattttctgtctgttctcgattcagcgagagcaaggatatacagtat
tcctggaaagagatcaagctgagagccagcgaggttctcgaagagcaatcgctttcaaag
tga

DBGET integrated database retrieval system