KEGG   Solenopsis invicta (red fire ant): 105199109Help
Entry
105199109         CDS       T03916                                 

Definition
(RefSeq) myotubularin-related protein 6
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00562  Inositol phosphate metabolism
soc01100  Metabolic pathways
soc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105199109
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105199109
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:soc01009]
    105199109
Enzymes [BR:soc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     105199109
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     105199109
Protein phosphatases and associated proteins [BR:soc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    105199109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc Y_phosphatase 3-PAP GRAM Vps36_ESCRT-II Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 105199109
NCBI-ProteinID: XP_011164369
Position
Unknown
AA seq 668 aa AA seqDB search
MDQIKVPKIENVRMLDKYSNNHSIGTLYLTVTHLIFVERSGKKKIWVLYTHISNIEKQPL
TTTGSPLYIKCKHFFIVTFVIPKERDCHEIYLTLLKLSCPASVEDLYCFNYQESKDTLPQ
HAGWNFFNVQSEFQRQGVPNEEWSLSYLNINYELCDTYPKYLYVPSTSTKNILLGSAKFR
SRGRLPVLTYLHSNKAAICRCSQPLSGFSARCPEDEEMMHNILCTNLNSRYMYVVDTRPR
INAFANRAAGKGYENENFYDNIKFHFFGIENIHVMRTSLNKLLDLQRSTSMSAFLSGLES
SGWLKHIRSILETAWFIARAVSNGVSVVVHCSDGWDRTAQVCSLAALMLDPFYRTIQGFQ
ALIEKDWLSFGHKFSDRCGYVSSDGKELAPIFTQFIDATYQLLQQYPYKFQFNEYFLLTL
HDHVHSCQHGTFIGNTEKERQILRLSERTYSLWGYLANNMNEYINPIYRCNRYNNEDSAD
ILQPKLAPQSIVLWRGLYFRFENGIHPREACDDLILTIYDHTSSLEDHVKLLLKRVNSLG
QLLNTNNAQKKGKHKFDNKFMKDSLSETIIENTANHDEKTKAKLRANQVENELKTVALEW
KSSRNMEECGCSTTFDAFNKKHHCWSCGDVLCTRCMAAHTKLSGHLSQRAVPTCKSCYQS
FGISATSP
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggatcagataaaggtccctaagatagagaatgtgaggatgcttgataagtatagcaat
aatcattccattggcacactctacctaacagtgacacacctcatctttgttgaaagaagt
ggcaaaaagaagatatgggtgctgtacacacatatctctaatatagagaaacagccattg
acaaccacaggatcaccattgtatattaaatgcaaacatttcttcattgtcacatttgtt
atcccaaaggaacgcgattgccatgagatttatctcacgttattgaaattatcctgccca
gctagcgtagaagatttatattgcttcaattatcaagaaagcaaggatacattacctcag
cacgcaggatggaacttcttcaatgtacaaagcgaatttcaacggcaaggtgtaccaaac
gaggagtggtcgctttcgtatttaaatattaattatgagctttgcgatacttatccaaag
tacttatacgttcccagtacatctactaaaaatattttattaggcagtgcaaagtttaga
agcagaggaaggctaccagttttaacttatttgcattcaaacaaggctgctatttgccgc
tgcagtcaaccactctcgggatttagcgcgcggtgtccagaagacgaagaaatgatgcat
aatatattatgtacaaatcttaattcccggtatatgtatgttgttgatacaaggccacgg
attaatgcctttgctaacagagctgcaggaaaaggatatgaaaacgaaaatttctatgac
aatatcaagtttcatttcttcggaatagaaaacattcatgtaatgagaacgagtttaaat
aaacttttggatttacaaagatcaacctccatgagtgcattcttgagcggtcttgaaagc
agcggttggctaaagcatattcgttctatcctggaaaccgcttggttcatcgcacgagca
gtttcaaacggcgtgagcgtggtagtgcattgtagcgatggatgggatcgcacagcgcaa
gtgtgctccctggccgcattaatgttggatccattttatagaacgatccaaggctttcaa
gctttaatagaaaaggattggctgtcgtttggtcataaatttagtgaccgctgtggctat
gtcagtagcgatggtaaagaactcgcaccgatatttacacaatttatagatgcaacgtac
caattgctacagcaatatccatataaatttcaattcaatgagtattttcttttaacatta
catgatcatgtacatagttgtcaacacggtacgttcatcggaaacactgagaaagaaagg
caaatattaagattatccgagcgaacatattcgttatggggctacttagcaaataatatg
aatgagtatataaacccaatctacagatgtaatcgttacaataacgaagattccgctgac
attcttcaacctaaattggcacctcaatctatcgttctttggagaggattatactttaga
tttgagaatggaatacatcctagagaagcgtgcgacgacttaattctgacgatttatgat
cacacaagttctttagaagatcacgtaaagcttctgttaaaacgagtcaattctttggga
caacttttaaatacgaataatgctcaaaagaaaggaaaacataaattcgataataaattc
atgaaagactctctgtcggagactataatcgagaacaccgcaaatcatgatgaaaaaacg
aaagctaaactaagagcgaatcaagtggaaaatgaattgaagacagtcgctttagaatgg
aaatcgtcgcggaatatggaagaatgtgggtgttctaccacattcgatgctttcaacaaa
aagcatcattgttggtcctgcggtgacgtattatgtacaagatgcatggcggcacatact
aaattatctggacatctgtcacagcgtgccgtacctacgtgcaaatcgtgctaccaaagt
ttcggtatatctgctactagtccttga

DBGET integrated database retrieval system