KEGG   Solenopsis invicta (red fire ant): 105201052Help
Entry
105201052         CDS       T03916                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
soc  Solenopsis invicta (red fire ant)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:soc01002]
    105201052
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:soc04147]
    105201052
Enzymes [BR:soc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105201052
Peptidases [BR:soc01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105201052
Exosome [BR:soc04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105201052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 105201052
NCBI-ProteinID: XP_011167237
Position
Un
AA seq 357 aa AA seqDB search
MSMYLLLAAIVPIVILEIWYMGICLTWTMKISLLLYLIIFGLLPLIFHYSYTLQKKILFL
NFVYWPLKVEFNPKLIGLEGARNFYLHTDQQVKIGAWQILPRSLLNNSIPATDEAYEAVL
SNAEQPVFLYMHGNSGNRASSHRLELYKLFQDLDYHVICFDYRSYGDSDVVELSEKGVVM
DSKYVLEWVMKKVNGSAPIFVWGHSLGTGVSTHVLDLLAAENIQPTGLFLEAPFNNIQDE
LTEHPFAQVFKHLPWFHWIAVEPFYKNNLRFESDKHITKINCPIIILHAEDDGVIPVFLA
EKLYQSAVDSFGNNTNRIEMIKIDSSYGFGHKYICRWKELPNIIKTFVVKAHGNWTE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgtacctactattagcggcgatagtaccgatcgtcatccttgagatttggtac
atgggaatatgcctgacttggactatgaagatatctttgctgctatatcttattattttt
gggcttctgcctctaatttttcattattcttatactcttcagaagaagatacttttttta
aattttgtatattggccacttaaagtagagtttaatccaaaattgattgggctggaaggt
gctagaaatttttatttacatactgaccagcaagtaaagataggtgcatggcagatatta
ccacggtctttattaaataattccattcctgcgacagatgaagcttatgaggcagtttta
agtaatgctgaacaacctgtatttttgtacatgcatggaaatagtggtaatagagcaagt
tcgcatagactcgagctttataagctcttccaagatctagattatcatgttatatgtttt
gattatagaagctatggcgatagcgatgtagtcgagctctccgagaaaggcgtagttatg
gatagtaaatatgttcttgagtgggtaatgaaaaaagttaatggttccgctccgattttt
gtttgggggcattctctaggaaccggagtttctacgcatgtattagatctgctagcagct
gagaatatacaaccaactggattgtttctggaagctccatttaataacatacaagatgaa
ttaacagaacatccgtttgcacaggtattcaagcacttaccatggttccattggatagca
gttgaaccattttataagaataatctgagatttgagtctgacaagcatattactaagatt
aactgtcctattataatattacatgctgaagatgatggtgtaattccagtttttttggca
gaaaagctttatcaatcagcagtagatagttttgggaataatacaaatcgtattgaaatg
ataaaaatagattcatcctatggatttggacataaatatatctgtaggtggaaggaattg
cctaatataattaagacatttgtcgtcaaagcacatggaaattggactgaataa

DBGET integrated database retrieval system