KEGG   Solenopsis invicta (red fire ant): 105203613Help
Entry
105203613         CDS       T03916                                 

Definition
(RefSeq) annexin B9
  KO
K17095  annexin A7/11
Organism
soc  Solenopsis invicta (red fire ant)
Brite
KEGG Orthology (KO) [BR:soc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:soc04147]
    105203613
Exosome [BR:soc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105203613
  Exosomal proteins of other body fluids (saliva and urine)
   105203613
  Exosomal proteins of colorectal cancer cells
   105203613
  Exosomal proteins of bladder cancer cells
   105203613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin DUF1678 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 105203613
NCBI-ProteinID: XP_011170758
UniProt: E9J8L4
Position
Unknown
AA seq 324 aa AA seqDB search
MSQQQYYPFKCTPTVYPAEPFDANADATILRKAMKGFGTDEKAIIDVLTKRGIVQRLEIA
EAFKTMYGKDLINDLKSELTGKLEDVIVALMTPLPHYYAKELHDAVSGMGTDEEAIVEIM
CTLSNYGIRTIATFYENLYNKTLESDLKGDTSGNFKRLLVSLVQANRDENQGIDHAQAVA
DAQALYEAGEKQWGTDESQFNAILVSRSYQQLRQTFIEYEKISGHDIEVAIKKEFSGSIE
KGLLGIVKCVKSKVGFFAERLYASMHGIGTKDRTLIRIIVSRSEIDLGDIKKAFEERYGK
SLESWIAGDTSGDYKKVLLSLVST
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcagcaatattatccgttcaagtgcactccaactgtatatcccgccgagccg
ttcgatgcaaatgcggacgccactattttgcgtaaagcaatgaagggatttggtacagat
gaaaaggcgatcatcgatgtgcttacgaagagaggtattgtacagagactggagatcgcg
gaggcgttcaagaccatgtatgggaaggatttgattaatgatttgaagagcgagttaact
gggaaactggaggatgtcattgttgccctcatgactccgttgccacattattatgccaaa
gaactgcatgatgcggtgagcggtatgggtaccgatgaagaggcaattgtcgagattatg
tgcactcttagcaactatggcatccgtacgatcgcgacattttatgaaaatttgtacaac
aaaacacttgagagcgatttaaaaggcgatacatctggtaatttcaagagattgttagta
tccctcgtgcaggcaaacagagacgaaaatcagggaatcgatcatgcccaagcagttgcc
gatgctcaagcgttgtacgaagctggtgaaaaacagtggggaacagacgaatctcaattc
aatgcgatcttggtatctcgcagctatcagcagctacgacaaacatttatcgagtatgaa
aaaatatcagggcacgacatagaagttgccataaagaaggaattctctggcagcatcgag
aaaggcttacttggaatagtgaaatgcgtgaagtcaaaggttggattttttgctgagcgt
ttgtatgccagtatgcacggcataggtacgaaggatcgaacactaatccgtatcattgtg
tctcgaagtgaaatcgacttgggcgatattaaaaaagcattcgaggaacgctatggaaag
tcactggaaagctggatagctggagacacttcgggagattacaagaaggtgcttctttcc
ttggtttccacataa

DBGET integrated database retrieval system