KEGG   Solenopsis invicta (red fire ant): 113002630Help
Entry
113002630         CDS       T03916                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc03040  Spliceosome
soc04141  Protein processing in endoplasmic reticulum
soc04144  Endocytosis
soc04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:soc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113002630
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113002630
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113002630
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    113002630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:soc01009]
    113002630
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:soc03041]
    113002630
   03009 Ribosome biogenesis [BR:soc03009]
    113002630
   03110 Chaperones and folding catalysts [BR:soc03110]
    113002630
   04131 Membrane trafficking [BR:soc04131]
    113002630
   03051 Proteasome [BR:soc03051]
    113002630
   03029 Mitochondrial biogenesis [BR:soc03029]
    113002630
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:soc04147]
    113002630
Protein phosphatases and associated proteins [BR:soc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113002630
Spliceosome [BR:soc03041]
 Complex B
  Other components
   Prp19 complex
    113002630
 Complex C
   Prp19-CDC5 complex
    113002630
Ribosome biogenesis [BR:soc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113002630
Chaperones and folding catalysts [BR:soc03110]
 Heat shock proteins
  HSP70 / DNAK
   113002630
Membrane trafficking [BR:soc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113002630
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113002630
Proteasome [BR:soc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113002630
Mitochondrial biogenesis [BR:soc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113002630
Exosome [BR:soc04147]
 Exosomal proteins
  Proteins found in most exosomes
   113002630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A HORMA
Motif
Other DBs
NCBI-GeneID: 113002630
NCBI-ProteinID: XP_025995000
Position
Unknown
AA seq 644 aa AA seqDB search
MAKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPSNTIFDAKRLIGRRFDDATVQSDMKHWPFTVVNDGSKPKIEVSYKGEMKTFFPEEVS
SMVLTKMKETAEAYLGKTITNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
IAYGLDKKAAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FVQEFKRKYKKDLSSNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRA
RFEELCADLFRSTLEPVEKALRDAKMDKAQVHSIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSEAVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAIEKSTGKENKITITNDKGRLSKEDIERMVNEAEKYRSEDEQQRERISAKN
SLESYCFNMKSTMEDDKVKDKIDASDKEKVLSKCSEVISWLDANQLAEKEEFADKQKELE
AICNPIITKLYQSGGAPEGGFPGAGGARPNPGSGGAGPTIEEVD
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcacccgcgatcggtatcgatcttggcacgacttactcctgcgtcggtgtc
ttccagcacggcaaggtcgagatcatcgctaatgaccagggtaaccgcaccacgccgagc
tacgtcgccttcaccgacaccgagaggctgatcggcgatgcggcgaagaaccaggtagcc
atgaatcccagcaacaccatctttgacgcaaaacgcttgatcggtcgtcgcttcgatgat
gcgacggtgcagagcgacatgaagcactggccattcacagtggtcaacgacggcagcaag
ccgaagatcgaagtgtcttacaagggcgagatgaaaaccttcttccccgaggaggtgtcc
tccatggtcttaacgaaaatgaaggagacagcagaagcttacctaggcaagactataaca
aatgctgtcatcaccgtgccggcttatttcaatgactctcagaggcaggcgacgaaggat
gccggcgcaattgctggcctgaatgtccttaggataataaacgagcctacggccgctgca
atagcgtacggtcttgataagaaggccgcgggtgagaagaatgtcctgatcttcgacttg
ggcggtggtacctttgatgtgtcgatcctgacaattgaggacggtatcttcgaagtaaaa
tccacggccggcgacacgcatctcggtggcgaggactttgacaatcgaatggtaaaccac
ttcgtgcaagagtttaagaggaagtacaaaaaagatctgagcagcaacaagagagctgtg
aggcgcttgaggaccgcctgcgagagagcgaagagaacgttgagctcgtcgacgcaggcg
agcatcgagattgactcgttgtttgagggtatcgacttctacacatcgatcactagggcc
aggttcgaggaactctgcgccgacttattcagaagcactctcgaacccgttgagaaggca
cttagagacgcaaagatggacaaggctcaagttcacagcattgttctggttggtggctcc
accaggataccaaagattcagaagttacttcaagacttcttcaacggcaaggaattgaac
aaatctatcaatccagatgaggctgttgcctacggcgcggcagttcaggcggcgattctg
cacggtgacaaatctgaggcggttcaagatttgctcctgctggatgtgactccgttgtcg
ttgggtatcgagaccgctggcggcgttatgaccaccttgatcaagaggaacacgacgatc
ccaacgaaacagactcagacgtttactacatattccgacaatcaaccgggagtacttatc
caagtttacgagggtgagagagcgatgactaaggacaacaatatcctcggcaaatttgag
ctgacgggtatacctccggcgcctagaggggtaccgcaaatcgaagtcacctttgacatc
gacgccaatggcatattgaatgtctctgcaattgaaaaatctacgggcaaagagaataag
atcacgattaccaatgacaagggtcgcttatcgaaggaagacatagagaggatggtgaac
gaagccgagaaataccgatcggaggatgaacaacagcgtgaaaggatttccgctaagaac
tccctcgagtcgtattgcttcaacatgaagagtacgatggaagacgacaaagttaaagat
aagattgatgcatccgacaaagagaaggtcctttccaaatgtagcgaggtcatctcctgg
ttagatgcgaatcagttggcggagaaggaagagtttgcggacaagcagaaggaactagaa
gccatttgcaatcccatcatcacgaaactctatcaaagtggcggagcgcctgagggtggc
ttccctggtgctggcggagcaagacccaatcctggttctggtggcgctggaccaaccatc
gaggaagtcgactaa

DBGET integrated database retrieval system