KEGG   Solenopsis invicta (red fire ant): 113002782Help
Entry
113002782         CDS       T03916                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00071  Fatty acid degradation
soc00410  beta-Alanine metabolism
soc00592  alpha-Linolenic acid metabolism
soc00640  Propanoate metabolism
soc01040  Biosynthesis of unsaturated fatty acids
soc01100  Metabolic pathways
soc01212  Fatty acid metabolism
soc04146  Peroxisome
Module
soc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
soc_M00087  beta-Oxidation
soc_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    113002782
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113002782
   00592 alpha-Linolenic acid metabolism
    113002782
   01040 Biosynthesis of unsaturated fatty acids
    113002782
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113002782
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113002782
Enzymes [BR:soc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     113002782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX
Motif
Other DBs
NCBI-GeneID: 113002782
NCBI-ProteinID: XP_025985715
Position
Unknown
AA seq 129 aa AA seqDB search
SRLGDIRAQNDANCTYEGENNVLIQQASNWLLNQWAAVIKGEPVISPLGSADFLVNAEQI
LSTKFNQTTVEGVLKPENLLLVFKWLVCYYLNKTYRRMMELKSSGMSDFDVRNNIQTFLA
RTLSLVYAE
NT seq 389 nt NT seq  +upstreamnt  +downstreamnt
tgtcacgtttgggtgacatcagagctcaaaatgatgcaaattgtacgtatgagggcgaaa
acaacgtacttattcaacaagcaagtaattggttgttaaatcaatgggctgctgtgatta
aaggagaacctgtcatatcaccgcttggttctgccgattttcttgtaaacgcagaacaaa
tacttagcactaaatttaatcaaactacagtggaaggtgtactgaagcccgaaaatttgc
tcttagtttttaaatggctggtttgttattatttgaataagacatatcgacgtatgatgg
aacttaaatcaagcggaatgtctgattttgatgtacgaaataatatccaaacgtttctag
cacgaacattgtctctggtatatgcagag

DBGET integrated database retrieval system