KEGG   Solenopsis invicta (red fire ant): 113003556Help
Entry
113003556         CDS       T03916                                 

Definition
(RefSeq) arginase-like
  KO
K01476  arginase [EC:3.5.3.1]
Organism
soc  Solenopsis invicta (red fire ant)
Pathway
soc00220  Arginine biosynthesis
soc00330  Arginine and proline metabolism
soc01100  Metabolic pathways
soc01230  Biosynthesis of amino acids
Module
soc_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:soc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    113003556
   00330 Arginine and proline metabolism
    113003556
Enzymes [BR:soc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     113003556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 113003556
NCBI-ProteinID: XP_025989241
Position
Unknown
AA seq 142 aa AA seqDB search
LSIRNVAYIGLRSIDRYERLVIEKFGITAYGMEDVERYGIHDVIHMALNKIDPHNSRSLH
VSFDIDALDPLEAPSTGTPGLYYTNISKCHSYLKIKMIKKRLETLSKKKLYFLFKPENLF
TRIVLFLALTTSHTTHGRPSDI
NT seq 430 nt NT seq  +upstreamnt  +downstreamnt
attatctatcagaaacgtagcttatattggtttgagatccatagatcgctatgaaagatt
agtaattgaaaaattcggtatcaccgcttatggcatggaagatgtagaacgttatggtat
tcacgatgtgattcatatggcacttaataagatagatcctcataactcaagatctctaca
cgttagttttgatatagatgcattggatcctcttgaagcacctagcactggaacgccagg
tttgtattatactaatatatctaaatgtcattcttatttaaagataaaaatgatcaaaaa
aagactagaaactttgagtaaaaaaaaactatattttttattcaaacctgaaaatctttt
tactcgaatagtattatttttggcattgacaacatcccatacaacacatggacgtccttc
agacatctaa

DBGET integrated database retrieval system