KEGG   Sodalis praecaptivus: Sant_0372Help
Entry
Sant_0372         CDS       T03004                                 

Gene name
pckA
Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sod  Sodalis praecaptivus
Pathway
sod00010  Glycolysis / Gluconeogenesis
sod00020  Citrate cycle (TCA cycle)
sod00620  Pyruvate metabolism
sod01100  Metabolic pathways
sod01110  Biosynthesis of secondary metabolites
sod01120  Microbial metabolism in diverse environments
sod01130  Biosynthesis of antibiotics
sod01200  Carbon metabolism
Module
sod_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sant_0372 (pckA)
   00020 Citrate cycle (TCA cycle)
    Sant_0372 (pckA)
   00620 Pyruvate metabolism
    Sant_0372 (pckA)
Enzymes [BR:sod01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Sant_0372 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: AHF75477
UniProt: W0HSJ5
Position
complement(424610..426229)
Genome map
AA seq 539 aa AA seqDB search
MVSERITPQQWLSYGITGCRELVYNPDYDQLFAEETDPALSGFERGTLTQSGAVAVDTGI
FTGRSPFDKYLVRDAKTRDTLWWSDQGKGANDNHPLDQQTWDHLKKRVGQQLSGKRLFVI
DAFCGANEDSRLKVRFVTEVAWQAHFVKNMFIRPSDEELRGFEPNFVVLNGAKCTNPDWR
EQGLHSENFVAFNLTEGIQLIGGTWYGGEMKKGLFSVMNYLLPLKGIASMHCSANVGADE
DVALFFGLSGTGKTTLSTDPRRRLIGDDEHGWDDDGVFNFEGGCYAKTIRLSPEAEPEIY
QAIRRNALLENVVVRADGSVDYDDGSKTENARVSYPIDHIENIVKPVSRAGHATRVIFLT
ADAFGVLPPVASLSMEQAQYHFLSGFTAKLAGTERGVVAPVPTFSACFGAAFLSLHPTAY
ADVLAKRMNAAGARAFLVNTGWNGSGKRISLKDTRAIINAILRGDIDDAPTATLPIFNLT
IPTALPGVDGAILDPRATYANAGEWRTKAEDLAQRFSDNFAKFTDTPAGAALVSAGPQR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtgagaggattaccccgcagcaatggctcagttatggaataacgggctgccgc
gaactggtgtacaacccagactacgaccaactgtttgcagaagagaccgaccccgccctc
agcgggttcgaacgcggaacccttacccaatcgggcgcggtggcggtggataccgggatt
ttcaccggtcggtcgccgttcgataagtatctggtgcgtgacgctaagacccgcgacacc
ctgtggtggtccgatcagggcaaaggcgccaatgacaatcatccccttgaccagcagacc
tgggatcaccttaaaaagcgggtcggccagcaacttagcggcaagcgcctgtttgtcatt
gatgctttctgcggtgccaatgaggatagccgacttaaggtgcgttttgtcaccgaggtc
gcctggcaggcgcacttcgtcaaaaatatgttcatccggccaagcgacgaggagctgcgc
ggctttgaaccgaattttgtggtgcttaacggcgccaaatgcaccaaccccgactggcgt
gaacagggcctgcattcagaaaactttgtcgctttcaatctcacggaaggcatccagctt
atcggcggcacctggtacggcggcgaaatgaaaaaagggctgttctcggtaatgaactac
ctgctgccgctaaaggggatcgcatccatgcactgttcggccaacgtcggcgccgatgag
gatgtcgcgctgttcttcggcctttccggcaccggcaaaaccacgctgtcgaccgacccg
cgccgccgtctgatcggtgatgatgaacacggctgggacgacgatggcgtattcaatttt
gaagggggctgttacgccaaaactatccgcctttcccccgaggccgagccggagatttat
caggcgattcgccgtaacgcgctgctggaaaatgtggtggtgcgggcggacggcagcgtg
gattacgacgacggcagtaagaccgaaaacgcccgcgtctcttatcccatcgatcatatc
gagaatatcgtcaaaccggtgtcgcgcgcgggacacgcaacgcgcgtcattttcctgacg
gcggatgcctttggcgtcttaccgccggtcgccagcctgtcgatggaacaggcgcagtat
catttcctgtccggctttaccgccaaactggcggggaccgagcggggcgtggtggcgccg
gtgcccaccttctccgcctgctttggcgcggcatttttgtcgctgcatcccaccgcctac
gccgatgtgctggctaaacgcatgaacgccgccggcgcccgcgcctttttggtcaatacc
ggctggaacggcagcggtaaacggatctccctcaaagacacgcgggcgattatcaacgcc
attttacgcggcgatattgacgatgcgccgacggcgaccctgcctatcttcaatcttacg
atacctaccgcgctgccgggcgtggacggcgcgatcctcgacccgcgcgctacctacgcc
aatgccggcgaatggcggaccaaggcggaagatttggcccagcgttttagcgataatttc
gccaaatttaccgacaccccggcaggggcggcgctggtgagcgcgggtccgcagcgctga

DBGET integrated database retrieval system