KEGG   Sodalis praecaptivus: Sant_3499Help
Entry
Sant_3499         CDS       T03004                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sod  Sodalis praecaptivus
Pathway
sod00230  Purine metabolism
sod00250  Alanine, aspartate and glutamate metabolism
sod01100  Metabolic pathways
Module
sod_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sod00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Sant_3499 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sant_3499 (purA)
Enzymes [BR:sod01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Sant_3499 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AHF78486
UniProt: W0HXC5
Position
complement(4007124..4008422)
Genome map
AA seq 432 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVVSIIANGVVLSPEALMKEMGALEARGIPVRERMLISEACPLILAYHVAMDVAREK
ARGAKAIGTTGRGIGPAYEDKVARRALRVGDLFNKDTFAAKLKEVVDYYNFQLVQYYQAE
AVDYQTVLDDILAVADVLTGMVVDVSELLDAARKRGDLMMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELFDDTGEFLCAKGNEFGA
TTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLQEVKICTAYRLPDGRVVESTP
LAAENWEGIEPIYETLPGWSESTFGVKQFDKLPDAARRYIKRIEEVTGVPVDIVSTGPDR
SETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaacgtcgtcgtactgggcacccaatggggtgacgaaggtaaaggcaaggtc
gtcgacctgctgaccgaacgggccaaatatgttgttcgctatcagggcggacataacgcc
ggtcatactttagttatcaacggtgaaaaaaccgtccttcatttgatcccctcaggcatt
ctgcgtgaaaacgtcgtcagcatcatcgccaacggcgtcgtgctgtcgccggaagcgttg
atgaaagagatgggagcgctggaagcgcgcggtattccggtacgcgaacgcatgctgatt
tccgaggcgtgtccgctcattcttgcctatcacgtagcgatggacgtcgcgcgcgaaaag
gcccgcggcgccaaagccatcggcaccaccggccgcggcatcggcccggcctatgaagat
aaagtggcgcgtcgcgcgctgcgcgtgggcgatctgttcaataaagacaccttcgccgcc
aagctgaaagaggtcgtggattactataacttccagctggtgcagtattaccaggctgaa
gcggtggattatcaaacggtactggacgatatcctggcggtggcagacgtcctgaccggg
atggtggtggatgtctccgagctgctggacgccgcccgcaaacgcggcgatttgatgatg
tttgaaggcgcccagggaacgctgctggatatcgaccacggcacctatccctacgttacc
tcctccaacaccaccgccggcggcgtcgcgaccggctccggcctcggtccgcgctatgtg
gattatgtcctcggcatcgtcaaggcctattccacccgcgtcggcgctggcccgtttccc
accgagctgtttgacgacacgggcgagtttctgtgcgccaagggcaatgaattcggcgcc
accaccggccgccgccgccgcaccggctggctggatgcggtagcggtacgccgcgcggtg
cagatcaactccctttccggtttctgcctcaccaagctcgacgtgcttgacggtctgcaa
gaggtgaaaatctgtaccgcttatcgcctgcctgacggccgcgtggtggaaagtaccccg
ttggcggcggaaaactgggaaggtatagagccgatttatgagacgttgccgggctggagc
gagagcaccttcggcgtgaagcagttcgacaagctgcccgacgcggcgcgtcgctatatc
aagcgcatagaagaggtgaccggcgtgccggttgacatcgtttcgaccgggcctgaccgt
agcgaaaccatgattctacgcgatccgtttgacgcctaa

DBGET integrated database retrieval system