KEGG   Spinacia oleracea (spinach): 110778554Help
Entry
110778554         CDS       T05137                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00480  Glutathione metabolism
soe00590  Arachidonic acid metabolism
soe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110778554
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110778554
Enzymes [BR:soe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110778554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 110778554
NCBI-ProteinID: XP_021838798
Position
Unknown
AA seq 239 aa AA seqDB search
MLRSSSSSIFSLLRQISIPVSFASIVSYNQLSFISKPTQFRSSFNFATLSSGYFNQSPFS
QSFRSQQTMASDSSAQPKSVHEFVVKDARGNDVDLSIYKGKVLLIVNVASQCGLTNSNYT
EMTELYEKYRELGLEILAFPCNQFGNQEPGSNEEVLEFACTRFKAEYPIFDKVDVNGSNA
APIYKFLKSSKGGLFGDGLKWNFTKFLVDKDGNVVDRYAPTTSPKSIEKDVKKLLGIQK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggtcttcttcatcctctattttctctctcctcagacaaatatctataccagtt
tctttcgcttcaattgtttcatacaatcaattatctttcatttctaaaccaacccagttc
agatcttccttcaactttgctactttgtcttctgggtattttaatcaatcccccttttct
caaagttttaggtctcaacaaactatggcaagtgactcttctgctcaacccaaatcagtt
cacgagtttgttgtcaaggacgcccgtggaaatgatgttgatcttagcatttacaaaggg
aaggtgctgttgattgtcaatgttgcatcacaatgtgggcttaccaactcaaactacaca
gagatgactgaattgtatgagaagtacagagaactaggtttggaaatcttggcatttcca
tgtaaccagtttggtaatcaagagccaggaagtaacgaggaggtcttggagtttgcatgc
acgcgtttcaaagctgaataccccatttttgacaaggttgatgtgaatggtagtaatgct
gccccaatctataagttcttgaagtcaagcaaaggtggactttttggagatggacttaag
tggaacttcactaagtttctcgttgacaaagatggcaacgttgttgatcgttacgcacct
actacttcaccaaagagcatcgagaaagatgtgaagaaactgttgggcatccaaaaataa

DBGET integrated database retrieval system