KEGG   Spinacia oleracea (spinach): 110778912Help
Entry
110778912         CDS       T05137                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe03040  Spliceosome
soe04141  Protein processing in endoplasmic reticulum
soe04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:soe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110778912
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110778912
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110778912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:soe01009]
    110778912
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:soe03041]
    110778912
   03009 Ribosome biogenesis [BR:soe03009]
    110778912
   03110 Chaperones and folding catalysts [BR:soe03110]
    110778912
   04131 Membrane trafficking [BR:soe04131]
    110778912
   03051 Proteasome [BR:soe03051]
    110778912
   03029 Mitochondrial biogenesis [BR:soe03029]
    110778912
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:soe04147]
    110778912
Protein phosphatases and associated proteins [BR:soe01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110778912
Spliceosome [BR:soe03041]
 Complex B
  Other components
   Prp19 complex
    110778912
 Complex C
   Prp19-CDC5 complex
    110778912
Ribosome biogenesis [BR:soe03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110778912
Chaperones and folding catalysts [BR:soe03110]
 Heat shock proteins
  HSP70 / DNAK
   110778912
Membrane trafficking [BR:soe04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110778912
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110778912
Proteasome [BR:soe03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110778912
Mitochondrial biogenesis [BR:soe03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110778912
Exosome [BR:soe04147]
 Exosomal proteins
  Proteins found in most exosomes
   110778912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A DUF1464 HOIP-UBA
Motif
Other DBs
NCBI-GeneID: 110778912
NCBI-ProteinID: XP_021839143
Position
Unknown
AA seq 575 aa AA seqDB search
MKPNRSNKVSPVEKVQCHAIGIDLGTTNSCAAVWKRGRVEIIANDKGSRTTPSCVSFTET
EHLTGDAAKNQIGLNSANTIYGVTRLIGRTFSDESVQHNMKLWPFKVVAGIETKKDRKPM
IAVSHKGEEKQFSAEEISAMVLMKMKESAECYLGSKVTDAVVTVPAHFNASQRQATKDAG
DIAGLNVIRIINEPVAAAVAAAVAYAVNKRKQTSTKLAEKVIIFDFGGGTLDVCLLTIDK
HDFKVKAIVGDAYLGGDDIDDRMVSHFAGYFERKHGKDISGNPRALARLRTACERAKREL
SSACETTIEINCLFESIDFFSVVSRSLFEKLNVDLFKRCIDCVKKCVQDGEMKMSDIHTV
VLVGGSSRIPKVQQMLQDLFEGKKLYRDINPDESVAYGAAILSKMLCGEKNTSNCKFADL
TPLSLGVEVYGGWMSVVVPKNITIPTKKTRGYTTKYDNQTTIRFSVYEGEKLKAIENKLL
DEFDFTDIPKAPAGIPKFDVYFDINSLGILTVTAEYRGTTNKQQITITNCSSTGQFKIAL
ERMIKDTNKINPNNFMAFAGAMLKSIRNKLKQMAC
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaatcgcagcaacaaggtttcacctgtggaaaaagtgcaatgccacgcaatt
gggatcgatttggggacaacaaactcatgtgctgcagtgtggaaacgtggtcgtgttgag
attattgctaatgacaagggcagccgaactacaccatcctgtgtctccttcactgaaact
gaacacctcactggggatgcagccaagaatcagattggcttaaactctgctaataccatc
tacggtgtaacgaggcttataggaaggacatttagcgatgaatcagtacagcataacatg
aaactgtggccgtttaaggttgttgctggtattgaaactaaaaaagacaggaagccaatg
attgcagtcagccacaagggtgaagagaaacagttttctgctgaggagatatcagctatg
gtgctgatgaagatgaaggagagcgctgaatgttatcttggttcaaaagtgacagatgca
gttgtaactgttcctgctcactttaatgcttcacagaggcaggcaaccaaagatgcgggt
gatatagcaggcctcaatgtcattcgtattataaatgagccagtagcagctgcagtagca
gctgcagtagcttacgctgttaacaagagaaagcaaacatcaaccaagttggcagagaaa
gtaattattttcgactttggtggggggactcttgatgtgtgtttgcttaccattgacaag
catgactttaaagttaaagctatagttggtgatgcctaccttggtggagatgatattgat
gatagaatggtgagtcactttgcgggatattttgaaaggaaacatggtaaggacatcagt
ggaaatcctagggctcttgcgaggttaagaactgcttgtgaaagagcaaagagggaactt
tcttcagcttgtgagacgaccattgagattaattgccttttcgagtccattgatttcttt
tctgttgtcagtcgttcactttttgagaagttgaatgttgatttgttcaagagatgtatc
gattgtgtgaagaaatgtgtgcaggatggtgaaatgaaaatgagtgatattcacacggtt
gtcctcgttggtgggtcgtccagaatccccaaggtccaacaaatgttgcaggaccttttc
gagggaaagaagctctacagagacattaaccctgatgagtcagtcgcgtatggagctgca
atcctttccaaaatgctgtgtggtgagaaaaatacttcaaactgtaaatttgctgatctt
actcctttgtccctgggtgttgaggtttatggtggttggatgagtgttgtagttccgaag
aacataaccatcccaaccaaaaagacaagagggtacaccactaaatatgacaaccagacc
accatcagattttcagtgtacgaaggtgagaaactcaaagctatagagaacaagctctta
gacgagtttgatttcaccgacattcctaaagcacctgcaggtataccgaaatttgatgtc
tattttgacatcaacagccttggtatcctgacagtgacagcagagtatagaggcacaacc
aacaaacagcaaatcaccattactaattgtagcagcacgggccagtttaagattgcgctt
gaaaggatgattaaagatactaacaagataaaccctaacaactttatggcatttgcaggt
gcaatgctcaaaagcattcgcaacaagttgaagcagatggcttgctga

DBGET integrated database retrieval system