KEGG   Spinacia oleracea (spinach): 110779406Help
Entry
110779406         CDS       T05137                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP40-like
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:soe03110]
    110779406
Enzymes [BR:soe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110779406
Chaperones and folding catalysts [BR:soe03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110779406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_11 TPR_8 TPR_14 TPR_6 TPR_7 TPR_19 TPR_16 TPR_9 PknG_TPR
Motif
Other DBs
NCBI-GeneID: 110779406
NCBI-ProteinID: XP_021839612
Position
Unknown
AA seq 362 aa AA seqDB search
MGVSSKKCYLDISIGGELEGRMIVELYNNVVPKTAENFRALCTGELGLSPISGLPLHYKG
IHFHRIVKGALIQGGDISGGKSDGESIYGTTFDDENFELRHERKGMLSMVNVGPNTNGSQ
FFITTTQTHQFNGKHVVFGRVIKGLGVIRSIEHVEVDGDNGPLLDIVIEDCGEIPEGEDY
GIINFFKDGDTYPDWPSDLDSKSDDFTWWVTAAECIKAFGNEKFKKEDYKMAIRKYLKAM
RYLDVCWDMEALDGEKSLSLRKLRSQFYTNTAACKLKMGDIEGALWDTDFALRDDEENVK
AHFRRGQAFIALTDIDSAVESFEKALELEPNDGAIKRELAATKKKIANRHNQEKKTYTRM
FQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgagttcaaaaaaatgttacttggatattagcataggaggtgagcttgaagga
agaatgattgtggagttatacaataatgtagttcctaaaactgctgaaaatttcagggct
ctttgtactggtgaattgggtctttctcctatttctggccttcctcttcactacaagggt
atacatttccatcgtattgtgaaaggggctcttattcaaggcggagacatatctgggggt
aaaagtgatggagaatccatctacggcacaacatttgatgatgagaatttcgagctgagg
catgaaaggaaaggaatgttatccatggttaatgttggccccaataccaatggatctcaa
ttcttcatcacaactactcaaactcatcagttcaatggtaagcatgttgtgtttggaaga
gtgatcaaaggtctgggtgttatacgctcaatcgagcatgttgaggttgatggtgataat
gggccgttgcttgatattgttatcgaggattgtggagagattcctgaaggggaagattat
ggcattatcaacttctttaaggatggggacacttaccctgactggccgtctgaccttgat
tccaaatcagatgatttcacttggtgggttactgctgcagaatgcattaaggcttttggt
aatgagaagtttaagaaggaagactataagatggctattcggaagtatctaaaagctatg
cggtacttggatgtgtgctgggacatggaagcattagatggagaaaagagtttgtcttta
aggaaattgaggtctcagttctacactaacactgcggcctgtaagttgaagatgggagac
atcgagggagcgttgtgggatactgactttgcacttcgtgacgatgaagagaatgtgaag
gctcatttccgaaggggtcaggcatttatcgctctcactgacatagattcagcagttgaa
tccttcgagaaggctttggaacttgaaccaaatgatggtgccataaagagagaacttgct
gccacaaaaaagaagattgctaatcgacacaaccaagagaagaaaacctacactagaatg
ttccaatga

DBGET integrated database retrieval system