KEGG   Spinacia oleracea (spinach): 110780924Help
Entry
110780924         CDS       T05137                                 

Definition
(RefSeq) glutathione S-transferase F10-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00480  Glutathione metabolism
soe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110780924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:soe02000]
    110780924
Enzymes [BR:soe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110780924
Transporters [BR:soe02000]
 Other transporters
  Pores ion channels [TC:1]
   110780924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 110780924
NCBI-ProteinID: XP_021840902
Position
Unknown
AA seq 160 aa AA seqDB search
MQLLAESRAICRYISEKYASQGNIKLYGINPLEKASIEQWIEAESQSFNPPSGSLVFQLA
FAPRMNIKQDEGLIKQSKEKLAKVLDVYDRRLGESRYLAGDDFTLADLSHLPNAQYLVNG
TDVGELFTSRDNVGRWWEEISSRESWKKVVEMQSSSFPKS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcaactccttgcagagtcaagagcaatatgccgttacatatcagagaaatatgcaagc
caaggaaacataaaactatatgggataaatccactggagaaagcatcaatagaacagtgg
atagaggcagagagccaaagcttcaatcctccatcaggaagcctggtatttcagttagct
tttgctcctcgcatgaacatcaaacaagacgaagggctgatcaaacagagcaaagaaaag
ctagcaaaagtgcttgatgtctatgacagaagactaggggagagccgttacttggctggg
gatgattttaccttagctgatctctctcacttgcctaacgcacagtatttggtgaatggt
actgatgttggtgagctgttcacgtcgagagataatgttggtagatggtgggaggagatt
tcaagcagggagtcatggaagaaggttgttgaaatgcaaagctcttcctttcctaaaagt
tag

DBGET integrated database retrieval system