KEGG   Spinacia oleracea (spinach): 110783034Help
Entry
110783034         CDS       T05137                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00052  Galactose metabolism
soe00500  Starch and sucrose metabolism
soe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110783034
   00500 Starch and sucrose metabolism
    110783034
Enzymes [BR:soe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110783034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 110783034
NCBI-ProteinID: XP_021843021
Position
Unknown
AA seq 508 aa AA seqDB search
MMYKGLYHLFYQYNPWGSIWGNIVWAHSVSKDLINWKALEPAIHGSEPFDINGVWSGSAT
ILPGNRPAILYTGITANNVQVQNVAFPANLSDPYLQKWVKPVYNPIITPGPEMNISTFRD
PTTAWWSGGHWNILVGSRRKHRGLVYLYRSRDFKKWTKAKHPLHSVSKTGMWECPDFFPV
PTQGKHGLDTSTMGSNVKHVLKVSLDITRYEYYTIGKYDPIINRYFPDNAEIDGWNGLRY
DYGNFYASKTFFDSEKGRRILWGWSNESWTPDVSAVKGWAGVQAIPRLLWLDPSGKQLLQ
WPVEEVERLRGNKVELKYHHLKPGNKFEIKGITPAQADIEVVFEIPSIEKAEVFDPKWVD
PQDLCIRMGSSNRGGVGPFGLLALASDNLEEYTSVFFRVFKTQNNKHVVLMCSDSSSSST
EKILYRPTFGGFVDVDLSADKKISLRTLIDHSILENFGAGGKTCIVSRVYPNIAIMDKAH
LHVFNNGSEAVIVEHLNAWSMKRPRMNN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacaagggtttgtaccatctcttttaccaatataatccatggggatctatatgg
ggcaacattgtttgggctcattcagtctcaaaggatctaattaactggaaagctcttgag
cctgcaattcacgggtccgaaccctttgacataaacggggtatggtccggttctgctacg
atcctacccggtaaccgacccgctatactttatacgggcattaccgcgaacaatgtacaa
gtccaaaatgttgcattcccagccaatttatcagacccatacctccaaaaatgggtcaaa
cccgtctacaacccgatcatcactccgggcccggaaatgaacatatcaacatttcgggac
ccgaccactgcatggtggtccggtgggcattggaatattttggtgggttcgaggagaaag
catagggggttagtatatttgtataggagtagggattttaagaaatggaccaaggctaaa
caccccttacattcggtctctaagacgggtatgtgggaatgtccggatttttttcccgtt
ccaacacaaggtaaacatgggttggacacttctactatgggctcgaacgtgaagcatgtg
ttaaaggttagtcttgatattacaaggtatgagtactacactattggaaaatatgatcct
attataaataggtattttccagacaatgctgaaattgatggttggaatgggttaaggtat
gattatggtaatttctatgcctcaaaaacgttctttgattctgaaaagggtcgtaggatc
ttgtggggttggtctaatgaatcttggaccccagacgtgagtgccgttaaaggttgggct
ggagttcaggctataccacgtttgttatggttggacccaagtgggaaacaattacttcaa
tggccagttgaggaagtggaaagactcaggggtaacaaggttgagctgaaatatcatcac
ctcaagccaggaaataaatttgaaatcaaaggcataactccagctcaggctgacattgaa
gtagtatttgagatcccaagtatagaaaaggctgaggtatttgacccgaagtgggtggat
ccccaagatttatgcattcgaatgggatcaagtaatcgaggaggggttgggccttttggg
cttctcgcacttgcttctgataatttggaggagtatacttctgtgtttttcagagttttc
aagacccaaaacaacaaacatgttgtccttatgtgctccgattcctcaagctcttcaacg
gaaaagatattatacagaccaacattcggtggttttgtagacgtagatttgagtgcagat
aagaaaatctctcttagaactttgattgatcactccatcttggagaattttggagccgga
ggcaaaacatgtatagtatccagggtatatcccaacatagcaatcatggacaaggcccat
ttacatgtctttaacaacggttcggaagccgttatcgtggaacatctcaatgcttggagc
atgaaaaggccgcgtatgaacaattag

DBGET integrated database retrieval system