KEGG   Spinacia oleracea (spinach): 110785628Help
Entry
110785628         CDS       T05137                                 

Definition
(RefSeq) glycine--tRNA ligase, chloroplastic/mitochondrial 2
  KO
K14164  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:soe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110785628
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:soe03016]
    110785628
Enzymes [BR:soe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     110785628
Transfer RNA biogenesis [BR:soe03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    110785628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_synt_2f tRNA-synt_2e DALR_1
Motif
Other DBs
NCBI-GeneID: 110785628
NCBI-ProteinID: XP_021845809
Position
Unknown
AA seq 935 aa AA seqDB search
MEAGNQGSNGIEVEGKEIKRLVQIVIYYLKGQDSSKSMVKMKVLTIRKVLTVRHHFGISG
LKQRLPLIVLSLVYASWSTCPLAGGLPLLPVSVEITYGLERILMLLQEVDHFKKIEYADG
ITYGELFSENEKEMSAYYLEHASVDHIKKHFDFFEEEARHLLELGLAIPAYDQLLKTSHA
FNILDSRGFVGVTERARYFGRMRSLARQCAQLWLKTRESLGHPLGVAAELGPLTSPSEIL
RSAVEKVSVEPRMFSLEIGTEELPSHDVPHATEQLKDLIVQLLEKQRLSHNEVQAFGTPR
RLVVCIDGLCAKQAENETEVRGPPVSKAFDGQGNPTKAVEGFCRRYNTSLDSIYEKLDGK
TQYIYARVTEPSRFSLEVLAEDLPGTIAKLSFPKSMRWNSQVLFSRPIRWIMALHGDVII
PFTFAGVYSGNLSYGLRNTPFATVKVESAESYIAVMKNAGISVDIEERKKVISEHSTALA
DTVNGQVIMPNGLLDEVVNLIEAPTPILGKFDESFLMLPKDLLTMVMQKHQKYFGIADKS
GKLLPYFIAVANGDINVDVVRKGNEAVLRARYEDAKFFYETDTRKKLSEFRGQLNGILFQ
EKLGTMLDKMTRVETIVTKLASPMGFHSEQLQTIQEAASLAMSDLSTAVVTEFTSLAGIM
ARHYALRDGYSEQIAEALYEITLPKHSGDILPKTDAGNVLAIADRLDSLVGLFGAGCQPS
STNDPFGLRRISYGLVQLLVENNKDLNFRDSLELAAEVQPVKVDSNTLDDVQQFVTRRLE
QYLVDKGINAEVVRSVLLERANWPCLAAKSAVKMEALFKDDLLPKVVEAYSRPTRIVRGK
YLDVNTEVNEAIFETKEERALWTAFLTVNKQVHQGIEIDTFVEASSELVQPLADFFDNVF
VMVEDEQVRNNRLALLKKIADLPRGIADLSSLPGF
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaggaaatcaaggttctaatggtattgaagtagaggggaaggaaataaaacga
ttagtacagattgtgatatattatttgaagggtcaagattcatccaaatcaatggtgaag
atgaaggttctcaccataagaaaagttctcaccgtaaggcatcatttcggtatcagtggt
cttaaacaaaggcttcctttaattgtgttgtctttggtgtatgcttcctggagtacttgt
cctctagctggaggtcttccattgttgccggtttctgttgaaatcacttatggcctagag
agaatcctcatgctgctccaggaagttgatcatttcaagaaaattgagtatgctgatggg
atcacatatggagaattgttttcagagaatgagaaggaaatgagtgcttactatcttgag
catgcctctgtcgatcatattaagaaacattttgatttttttgaggaggaagctcgccat
ctgcttgaattgggcctagcaatccctgcgtatgatcagcttctgaagacgtctcatgct
ttcaatattttagattctaggggctttgttggtgtaactgaacgtgctcgttactttggt
cgaatgcgaagtttagctcgtcaatgtgctcagttgtggctgaagacaagagagtctctt
ggccatcctttaggcgttgctgctgagcttggtcctctaacttctccgagtgagatcctc
cggtctgcagtagaaaaggtgtctgtagagccaaggatgttttcccttgaaattgggaca
gaagagttgccatcacatgatgtaccgcatgcaactgagcagttgaaagatcttattgtg
caattgctggaaaagcaaagattgagtcataatgaagtgcaagcatttggtacacctcga
agattggtggtttgcattgatggcttgtgtgccaagcaagctgaaaatgagactgaggtt
cgaggacccccagtttctaaggcatttgacggccaaggaaatccaacgaaggctgttgag
ggtttctgccgtagatataatacttcactggactccatatacgaaaaattagatgggaag
actcagtatatatatgctcgtgtaactgaaccctccagattttccttggaggttttagct
gaagatctccctggtaccattgctaagttatcgttcccgaaatcaatgcgttggaattct
caggttttgttcagtaggcctattcgttggattatggctcttcatggtgatgttattatc
ccatttacttttgctggagtttacagtggaaatttatcttatggtcttcgtaatacccct
tttgcaactgtcaaggtagaaagtgcagaatcctacatcgctgtaatgaagaatgctggt
atatctgttgatattgaggagcgtaaaaaagttatatcagagcattcaactgcgttagct
gatactgtaaacgggcaagtaattatgcctaatggtttattggacgaggtggtcaatttg
attgaagcacctactccaatactgggaaagtttgacgaatctttcctaatgcttccaaaa
gatctactaacaatggttatgcagaagcatcagaaatattttggaattgctgacaaaagt
ggaaagttgttgccatattttattgcggtggcaaatggagacattaatgtggacgttgtg
aggaaagggaatgaggcagtgctcagagcacgttatgaagatgcaaagtttttctatgag
acggacacaagaaagaagctttcagagtttagaggtcaacttaatggcatccttttccaa
gaaaagcttggaaccatgctggataaaatgacacgtgttgagactattgttaccaaatta
gcctcgcccatgggttttcattcggagcaactccagactatacaagaagctgcatccctt
gctatgtcagatctttctactgctgttgtgactgaatttacttctctggcaggaataatg
gctcggcattatgctttgagagatgggtactctgagcagattgctgaggctttatatgag
attacactccctaagcattcaggagatatattaccgaaaacagatgctggaaatgttctt
gcaatagctgacagactggacagccttgttggtttatttggggcaggttgtcagcctagt
tccacaaatgatccatttggtctgcggaggatttcatatggcctggtgcaactgttggtg
gaaaataataaagatttgaactttcgagattctctggagcttgctgcagaggttcaacct
gttaaagtggatagcaacacactagatgatgtacaacaatttgtaacacggaggctcgag
caatatctggttgacaagggaataaatgcagaagttgtccggtctgttctcttagagcgt
gcaaattggccatgtttggcagcaaagtcagcagtaaagatggaagccttgttcaaagat
gatctccttccaaaggttgtcgaagcatattcccggccgacaaggattgtccgaggaaag
tacctagatgtcaacacagaggtaaatgaagctatatttgagacaaaggaagagagagca
ttgtggactgctttcttgacagtgaacaaacaagttcatcaaggtattgaaattgacact
tttgttgaagcatcctcagaattagtacagccacttgctgatttctttgataacgtattt
gtaatggtggaagatgaacaggttcggaataataggcttgctctgctcaagaagattgca
gaccttcctagagggattgcagacctctcatctttgccaggattttga

DBGET integrated database retrieval system