KEGG   Spinacia oleracea (spinach): 110786297Help
Entry
110786297         CDS       T05137                                 

Definition
(RefSeq) mitogen-activated protein kinase 3-like
  KO
K20537  mitogen-activated protein kinase 7/14 [EC:2.7.11.24]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:soe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    110786297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soe01001]
    110786297
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110786297
Protein kinases [BR:soe01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110786297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 110786297
NCBI-ProteinID: XP_021846535
Position
Unknown
AA seq 349 aa AA seqDB search
MMMRINKKKNSSFRVEGSLFEIDSKYEPIDSIGKGSYGIVCSCRNTDTNEKVAIKKISDV
FSSQVDALRTLRELIILRNIRHHNVVQLKDVMITCSKSTFKEVYAVYEFMDSDLHQIIQS
PQPLSPEHCQYFMFQLLEGVKYLHLTNIIHRDLKPANLLINANCNMKICDFGLARTSGGD
GGEFMTEYVVTRWYRAPELLICRNSYDTSIDVWSVGCIFAEILLRRPLFPGHNPLDQLKR
VIDFLGSPTESDLDFLDNPKAINFIKGLPRTKGVCWKAMFPEADSLALDLLQRMLVFNPK
KRITIADALQHPYMFDLYNPTEYPPSHKTLDVNIIYICTNIIANNNSVI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgagaataaacaagaagaagaatagtagtttcagagtagaaggtagcttgttc
gaaattgatagtaagtacgaaccaattgatagtattggtaagggaagttacggcattgtt
tgttcttgtcgcaacacggatactaacgagaaggtcgctatcaagaagatatcggatgtg
ttttcgagtcaagtcgatgcattgaggacactgagggaacttattatactaaggaacatt
cgtcatcataatgttgttcaattgaaagatgttatgatcacttgttctaagtctactttt
aaggaagtttatgccgtttacgaatttatggatagcgatcttcatcaaattattcagtct
cctcagccactttctcctgaacactgccagtattttatgtttcagttgctggaaggggtc
aagtatcttcatttgaccaacatcattcaccgtgatctgaaaccagcaaacctccttatt
aacgcaaactgcaacatgaaaatatgtgattttggtctagcaagaacaagtggaggtgat
ggtggtgaatttatgacagagtatgtagtaacacgttggtatcgtgcacctgaactactc
atctgcagaaacagttatgacacatctattgatgtttggtcagttggttgtatctttgct
gaaatactattacgaagacccttatttcctggtcataatcccctcgaccaactcaaacgt
gtcattgacttccttggaagccctactgaatctgatcttgatttcctcgacaacccaaaa
gcaatcaacttcatcaaaggacttcctcgtacaaaaggggtctgttggaaggctatgttt
cctgaagctgattctttagccttagatttgctgcaaagaatgcttgttttcaaccccaag
aagaggattactatcgctgatgcccttcaacatccttatatgtttgatttgtacaaccct
acagaatatccaccttctcataagacacttgatgtcaatattatatatatctgtaccaat
attattgcaaacaacaactctgttatttga

DBGET integrated database retrieval system