KEGG   Spinacia oleracea (spinach): 110788713Help
Entry
110788713         CDS       T05137                                 

Definition
(RefSeq) uncharacterized protein LOC110788713
Organism
soe  Spinacia oleracea (spinach)
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 110788713
NCBI-ProteinID: XP_021849053
Position
Unknown
AA seq 215 aa AA seqDB search
MATTSTTTSLFYPHPSIKPSSTTSSPPTLLPFLSPRTRRTTRIMVTDFLGDFGARDPFPE
ELESNFGEKVLGNMSTEHKILIPQAIALALSQQSCIPVSPTDTPLSKDDAKQLLFKVIGW
RLLENEQEEDGKTVLKLTCLWKLKDVEAGVELKDRISKVVESAGHSLVFQQEDNKVTAVL
WTQIIGGLSINDFIVAAKIDEVNISDLLPRKRSWA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctaccacatccaccaccacctccctcttctacccccacccttccatcaaaccctct
tctactacttcctcacctcctacccttctccctttcctatcccctcgaacgcgccgtacc
actagaatcatggtcacagacttcctaggcgatttcggagccagagatccattcccagaa
gaactagagagcaacttcggcgaaaaagtcctaggaaacatgagcactgaacataagatt
ctcattcctcaagctatagctcttgctctttcgcaacagtcttgtattcctgtctctcct
actgatactcccttgtctaaggatgatgctaagcaactcctcttcaaggttatcgggtgg
cgattactcgaaaacgaacaagaagaagatggtaagactgtgttgaagttgacatgtttg
tggaagttgaaggatgttgaagctggggttgagttgaaagataggatttctaaggttgtt
gaaagtgcagggcattctcttgtgtttcagcaagaggataataaggtgactgctgttttg
tggactcagattattggtggtttgagtattaatgattttattgttgctgctaagattgat
gaggttaacatctctgatcttcttcctagaaagagatcttgggcttaa

DBGET integrated database retrieval system