KEGG   Spinacia oleracea (spinach): 110789162Help
Entry
110789162         CDS       T05137                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutathione S-transferase 2-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00350  Tyrosine metabolism
soe01100  Metabolic pathways
Module
soe_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110789162
Enzymes [BR:soe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     110789162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 110789162
NCBI-ProteinID: XP_021849508
Position
Unknown
AA seq 224 aa AA seqDB search
MEKPKLKLYSYWLSSCAWRVRIALNFKGVDFEYKAVNLVKGDQFTHEFQKLNPLSYVPVL
VDEDIVIADSFAIIMYLEEKYPQNPLLPQNLQKRALNYQAANIVASNIQPFQNLAVVKYI
EEKLGSDERLSWAQHHIKKGFAALEKLLAGHTGKYATGDEVALADLFLAPQIAGAMKRFN
IDMAEFPLLKRLNNAYSEQQHFRVLSQKNNQMLQTTPDLRTIFC
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccaaagctgaagctctactcttattggttgagttcttgcgcttggcgtgtc
cgtattgctctcaatttcaaaggggtggattttgagtacaaggcagtgaatttggtaaaa
ggagatcagtttactcatgagtttcagaaactgaatcctcttagttacgtgccggtgttg
gtggatgaggatattgtgattgctgactcgtttgcaattataatgtatttggaagagaag
tatcctcaaaatccgttgttgcctcagaatcttcagaaaagagccctcaattaccaggct
gcaaatattgttgcttcgaacatacaacctttccagaaccttgcagtagtgaagtatatt
gaagaaaaacttgggtcggatgaaaggctttcttgggctcaacatcatatcaaaaaaggc
tttgctgcattggagaagcttttggcaggacacactggcaaatatgctactggggatgaa
gttgccttggcagacttgtttctggcaccccaaatagcaggagcaatgaagagattcaat
attgacatggctgagttcccattattaaagaggttgaacaatgcatattcggagcaacag
catttcagagtgctctcccagaaaaacaaccagatgctccagacaacaccagatcttagg
accattttctgctga

DBGET integrated database retrieval system