KEGG   Spinacia oleracea (spinach): 110789237Help
Entry
110789237         CDS       T05137                                 

Definition
(RefSeq) wall-associated receptor kinase 5-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soe01001]
    110789237
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110789237
Protein kinases [BR:soe01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110789237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA cEGF FXa_inhibition hEGF EGF EGF_3 WAK Kinase-like
Motif
Other DBs
NCBI-GeneID: 110789237
NCBI-ProteinID: XP_021849576
Position
Unknown
AA seq 700 aa AA seqDB search
MLSALNITKPGCQRKCGNLTIPYPFGVGRGCSRSMWYDISCNASTNGDPPRAITTWVKDE
NENGMEILDISETHIRLRNQVAYSCFNSTAETSTFGSGFKSFDLFNSSVPFTLSSESNML
FIVGCHDLGYFDGNFDFRGSVFINSADQTGSCRTDCSFEAKNVVAGECDGIGCCQAIINK
GMKSYTVSLDPSANHTSFFSYNPCGYAFLADKEQFKFRGALDLHDPNFINRIIDEVPMVL
DWVIDNHTCSLAQQDPASYACDQQNTICVDAAESGIGGYRCSCRPGYQGNPYLTPGCSDI
NECENLSDSPCSVTCKNTPGNYNCSCPPGYSGDGEKLGTGCKPPFPFLKFGLGIGFGTLF
LLIGVSWLCMKIKKRRNVKMKEIFFQKNGGLMLKQLISSNKQDGIEQIKVFTMRELKVAT
KNFSEETIVGQGGYGTVYTGVLPNNEIVAMKRSKFMDQSQIEQFINELVILARIRHPNVV
RLLGCCLEDEVPLLVYEFISNGTLYNHIHNTKELSWYCWNNCLRISIESANAIAYLHSIP
IFHRDIKSMNILLDESYTTKVSDFGASRLIPLNHTHLSTVVQGTLGYLDPEYFFSSQLTE
KSDVFSYGVVLAELLTRAKPILPERQTEEKNRNLAAYFVKCVEENNLFDILDPQLVEEAS
QEQLTNIAKLVQKCLSVKGEDRPTMKEIAMELEEVQKQTR
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgctaagcgccttaaacatcactaagcctggctgccaacgcaaatgtggcaacctaacc
attccctacccttttggggtaggtaggggttgctcaagaagcatgtggtatgacatctct
tgcaatgcttccactaatggtgatccaccaagagcaataacaacttgggtaaaggacgag
aatgaaaatggcatggaaattcttgacatatctgaaacacatattcgtcttaggaaccaa
gtagcctatagctgcttcaactcaactgcagagacatctacattcggttcaggattcaag
tcctttgacctcttcaattcgagtgtacccttcaccttgtcaagtgagtcaaacatgctc
ttcattgtagggtgtcacgaccttggctattttgatggcaacttcgacttcagaggtagc
gttttcattaattcagccgatcaaactggctcttgtagaactgactgcagcttcgaggcc
aagaatgttgttgcaggtgaatgcgatggcattggttgttgtcaagccattattaacaaa
ggaatgaagtcctatacggtgtctctagatccgtccgcaaaccacacttcctttttctct
tacaacccttgtgggtacgcatttttggctgacaaagaacagttcaaatttcgcggggct
cttgatctacatgaccccaattttattaacaggataatcgatgaggtccctatggttcta
gattgggttatagacaatcatacttgttctctagctcagcaagatccggcctcttatgca
tgtgatcagcagaatacgatttgtgtagatgctgctgagagtggtatcggaggatatcgt
tgcagttgtcgtcctggttatcagggcaatccttatcttactcctggttgctcagatata
aatgagtgtgagaatctaagtgatagtccatgctccgtgacttgcaaaaataccccggga
aactacaattgttcttgtccacctggatattccggtgatggtgaaaaacttggcactggt
tgcaagccaccgtttccatttctaaagtttggcttaggtataggctttggcacattgttt
ttgctcattggtgtaagttggctatgcatgaaaattaagaaaagaaggaacgtaaaaatg
aaggaaattttctttcagaaaaatggaggtttgatgttgaagcaactaatctcttcaaat
aaacaagatggtattgaacaaattaaggtatttactatgcgagagttgaaggtcgcaaca
aagaacttcagtgaagaaacgattgtgggtcaaggtggttatggtacagtctacacaggt
gtgttaccaaataatgaaatagtagcgatgaagagatcaaagtttatggatcaaagtcaa
atcgagcaatttataaatgaattggtcattcttgcgcgaatacgacatcctaatgtggta
agacttttgggatgttgtctggaggatgaagtgcctttgttggtctatgaatttatctcc
aatggtacattgtataaccatattcataatacaaaggaactatcatggtattgttggaac
aattgtttgcggatctccattgagtcggctaacgcaatcgcatacttacattcgatacca
atatttcatcgagacatcaagtctatgaacattttacttgatgaaagttatacaactaaa
gtatctgatttcggagcttcaagattgattccattaaatcacactcatttatctactgtt
gtacaaggcacattaggatatctagatccagagtactttttctcaagtcaattaacagag
aagagtgatgtttttagttatggtgttgttctcgctgaactcttaacgagggctaaaccg
atcttaccagagagacaaacagaagaaaagaatcgcaatctggcagcatattttgtgaag
tgtgtagaagaaaataatctattcgatattctggaccctcaattagtggaagaagcatct
caagagcaacttactaacattgcaaagcttgtacaaaaatgcttaagtgttaagggtgaa
gacaggccaacaatgaaagaaattgctatggagctagaagaagtacagaagcaaacaagg
tag

DBGET integrated database retrieval system