KEGG   Spinacia oleracea (spinach): 110789342Help
Entry
110789342         CDS       T05137                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soe01001]
    110789342
   01009 Protein phosphatases and associated proteins [BR:soe01009]
    110789342
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110789342
Protein kinases [BR:soe01001]
 Serine/threonine kinases: Other
  Wnk family
   110789342
Protein phosphatases and associated proteins [BR:soe01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110789342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110789342
NCBI-ProteinID: XP_021849690
Position
Unknown
AA seq 710 aa AA seqDB search
MNAVIDNHDDFDDCSDYVETDPTGRYGRYNEILGKGSSKIVYRGFDEYEGIEVAWNQVKL
TDFLQRPEDLERLYSEIHLLKTLKHKNIMKFCTSWVDITNRNINFVTEMFTSGTLRQYRV
KHKKVNIRAVKHWCRQILEGLLYLHSHDPPVIHRDLKCDNIFINGNQGEVKIGDLGLAAI
LRKSHAARCVGTPEFMAPEVYAEEYNELVDIYSFGMCVLEMVTFDYPYSECTHPAQIYKK
VVSGKKPDALYKVKNPEVRLFVEKCLETVTSRLSAKELLEHPFLQNDDKGYNLRPIDDDK
DFDKISQVVQSPYQNERSLMNSSSGCDHAGCDYVGYEPDHEHEYQTLELAANEIELFTFL
EDDDLTDMDISIKGKKRANGDIFFRLRITDKEGRVRNIYFPFNIKSDTAMSVTTEMVSEL
SIKEEDMMRIADMIDCEIASLVPEWKKGTYEEENEYEYEASECESINNDNDSVIERYSLA
DYLTFGSPRPRNIQLLRCASHGSTSMRGRFEEITYPLEADPGVIANTDTVGHHQRRPSLN
FHFGETFEQQDQTSCENTINYSETQTPYNSPSGSIVDEREYENEARKELRWLKTKYEIQL
RDENESADMKMKTRLLAAEKDYHMKRNKKISFHPLERGLDVKDLKKALEKHFTPQFPSNH
AKKKLPSRMLQSECCSPENLVTSNKFYTGGPILPHSLHRTTSLPVDTLDF
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgtaattgataatcatgatgattttgatgattgttctgattatgttgagact
gatcccactggaagatatggaagatataatgaaattctgggcaaagggtcatctaagata
gtgtacagaggatttgatgaatatgaaggaattgaagtggcttggaatcaagttaagctt
acagattttctgcaaagacctgaagatctcgaaaggctttacagtgaaattcatctgctg
aaaaccttaaaacacaagaatattatgaagttttgcacttcgtgggttgacattaccaac
aggaacatcaattttgtcactgaaatgttcacctctggtactctgagacagtatagggtg
aagcataaaaaggttaacattagagcagtaaaacattggtgtaggcaaatcctagaaggg
ctattgtatcttcatagtcatgaccctccagtgatacacagagatctcaaatgtgacaac
attttcattaatgggaaccaaggtgaagtcaagattggagatcttggattagctgccata
ctgaggaaatctcatgctgcccgttgtgttggtacgccagaattcatggccccagaggtt
tatgccgaggaatacaatgaattagttgacatctactcgtttgggatgtgtgtactcgaa
atggttacctttgattatccttatagtgaatgcacacatcctgctcaaatctacaagaaa
gtagtttctgggaaaaagccggatgctctttacaaagtgaagaacccggaagtgcgcctc
tttgttgagaaatgcttagaaactgtcactagtagattatctgcgaaggagctactagaa
cacccatttttgcaaaacgacgataagggatataatttgaggccaattgatgatgataaa
gattttgacaaaataagtcaagtggttcaatcaccttaccaaaatgagaggtctttgatg
aatagtagtagtgggtgtgaccatgctggctgtgactatgttggctatgaacctgatcat
gaacatgagtatcaaacactagagttagcagccaatgaaattgagctatttacttttctg
gaggatgacgatttgacagatatggacatcagcatcaagggaaagaaaagagcaaatggt
gatatcttttttagactgagaattactgataaagaagggcgagtacgaaatatatacttc
ccttttaacattaagagtgatactgctatgagcgttactacggaaatggtttctgaactc
agtatcaaggaagaagacatgatgagaatagcagatatgattgattgcgagatagcttcc
ttagtccccgaatggaagaagggtacatacgaagaagaaaatgaatacgaatacgaagcc
tctgagtgtgaaagcataaacaatgataatgattcagtgattgagcgttattctttagca
gattatcttacctttggtagccccaggccccgcaatatccaactccttcgttgtgctagt
catggatcgacttctatgcgtggacgttttgaagagataacttatccattagaggctgat
ccgggtgtaatagcaaatacagatacagtgggtcatcatcaacgtcgacccagtttaaac
ttccattttggtgaaacctttgaacaacaagatcaaacaagttgtgagaataccattaat
tatagtgaaactcagacgccatacaactccccttctggttccattgtagatgaaagggag
tatgagaacgaggcaaggaaggagttgagatggctgaaaaccaagtacgaaatacagctg
agagatgaaaatgaaagtgcagacatgaagatgaagacacgtttgttagctgcagaaaag
gattaccatatgaagagaaacaagaagatatcatttcatccattggaaagaggattagat
gtgaaggatctgaagaaggcattggaaaagcactttacgcctcaatttccttcaaatcat
gctaagaagaagctcccaagtcgaatgcttcagagtgagtgttgtagcccagagaatttg
gtcacttctaacaagttttacacaggaggacctatcctccctcattctcttcatagaaca
acttctctacctgttgatacgttagacttttaa

DBGET integrated database retrieval system