KEGG   Spinacia oleracea (spinach): 110794300
Entry
110794300         CDS       T05137                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00100  Steroid biosynthesis
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
Module
soe_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110794300
Enzymes [BR:soe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110794300
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 110794300
NCBI-ProteinID: XP_021854939
Position
Unknown
AA seq 369 aa
MDLYSLLQSSIPSLTSVGLLLSYFGYLAVIGSVLPGKIVPGAILSDGTRLHYRCNGLLSS
ILSLLLLGGGIATGFVSPTVIVDRGLELLSATFIFSFVVSLLLCVAGCTSRDKGSSLKPY
VSGNWIHDWWFGIQLNPQFMGIDLKFFFVRAGILGWLLINLSILAKSIEDGNLNRSMVLY
QLYCTFYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLRNKVDLT
TAAVVANCIVFVMGYRIFREANRQKHVFKKNPKAPIWGKPPMVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPIPYFYPVYLLILLIWRERRDEARCAQKYKDIWAEYCKIV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctatactcattgcttcaatcatccatcccttctttgacttctgtgggtttattg
ctctcatattttggttacttggcggttattggctcagttttacctggcaagattgttccc
ggcgccattttatccgacggcactcgcctccattatcgctgcaatggtttgttgtcatcg
attttgtcgctgttgcttcttggtggtgggattgctactggattcgtatcgcctacagtc
attgttgacaggggactagagcttttatccgcaacctttatattcagttttgttgtaagc
ttgttactttgtgttgctggttgcacttctcgtgacaaaggttcatcactcaagccttat
gtatctggaaattggattcatgactggtggtttggaatacagctgaatcctcaatttatg
ggcattgatctcaaatttttctttgtgagagctgggatattgggctggttacttattaat
ctttcaattttggctaaaagtatagaagatggcaacttaaatcgatcaatggttctatac
cagctatattgcactttttacatcctggactatttcttctacgaggaatacatgacttcc
acttgggacataatcgcagagaggctgggatttatgttggtctttggggatcttttgtgg
attcctttcacatttagtatccagggatggtggcttttaagaaacaaggtggatttaacc
actgctgctgttgtggcaaattgcatcgtcttcgtaatggggtaccgcatattcagggaa
gctaacaggcagaaacatgtgtttaagaagaatcctaaagcaccaatatggggcaaacct
ccaatggtcattggaggaaaattgcttgcttctggctattggggaatcgctagacactgt
aactatctgggagacttgttattggcactgtccttcagcctaccctgtggaatcagctct
ccgattccttacttttatcctgtatatcttcttattttgctgatatggagagaaagaagg
gatgaagctcgatgtgcacagaagtacaaagacatttgggctgagtactgtaaaattgtg
ccctggagaattttgccatatgtttattag

DBGET integrated database retrieval system