KEGG   Spinacia oleracea (spinach): 110794565Help
Entry
110794565         CDS       T05137                                 

Definition
(RefSeq) autophagy-related protein 16 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:soe00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    110794565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:soe04131]
    110794565
   03029 Mitochondrial biogenesis [BR:soe03029]
    110794565
Membrane trafficking [BR:soe04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    110794565
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    110794565
Mitochondrial biogenesis [BR:soe03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    110794565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 eIF2A Cytochrom_D1 PQQ_2 DUF2935 FAM117 Lyase_N Fzo_mitofusin Exonuc_VII_L ApoA-II DUF4854 YabA Phlebovirus_NSM
Motif
Other DBs
NCBI-GeneID: 110794565
NCBI-ProteinID: XP_021855235
Position
Unknown
AA seq 514 aa AA seqDB search
MLKIRLNEEEFAIAAIKQALKALRQRHLAEEGAHAPAITAIARPLIYQGSEWKDKAEKLE
LELQQCYKAQSRLSEQLVVEVAEGRTAKALIQEKETAVANLEKEVTQLSDELSEFKKNLD
EKSKGVELLTSENQELKRQLDEMTMKAKNAEAENKMLIDRWMLQKMQDAERLNEANSLYE
DMLEQLKSSSIQQIARQQVDGVVRQCEEGAEFYVESTVPTTCNNRIHAHDGGCASILFEY
NSSKLITGGQDRSIKMWDTSTGSLSHTLYGCLGSVLDLTITNDNKTVIAASSSNNLYVWD
VSSGRIRHTLTGHTDKVCAVDVSKVSNRHVVSAAYDRTIKAWDLQKGYCTNTIIFPSNCN
AVCFSMDGRTICSGHVDGNLRLWDIQTGKLLSEVAAHSLAVTSISLSRNGNTILTSGRDN
VHNLFDMRTLEVYGTLRASGNRVASNWSRSCISADDNYVAAGSADGSVHIWSIQKGDIVS
TLKEHGSSVLCCAWSGLGKPLATSDKNGVICTWI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatcaggttgaatgaagaagagttcgccattgcagcaattaagcaagctttg
aaagcgcttcgacagcggcatttggcggaagaaggtgctcatgctccggcgatcaccgct
atagctagacctcttatctaccagggctcagaatggaaagataaagctgaaaaactggag
cttgaacttcagcaatgttacaaagctcaatctcgactatctgagcagcttgtggttgaa
gttgctgagggtcggacggccaaagctttgattcaagagaaagagactgctgtagctaac
ttggaaaaggaggttactcagctgagcgatgagctctcggagtttaagaaaaatttagat
gagaaaagtaagggtgtagaattgctgacaagtgagaatcaagagctgaaaagacaactt
gatgagatgactatgaaagcgaaaaatgcagaagctgagaataagatgttgattgatcgt
tggatgcttcagaaaatgcaagacgctgagcgtctcaatgaggcaaattctctttatgaa
gacatgcttgaacaactcaagtccagcagcatacaacaaattgctcggcaacaagttgat
ggtgtggttcgtcaatgtgaggaaggtgcggagttttatgtggaatcaacggttcctaca
acttgcaacaatagaatacatgctcatgatggtggatgtgcttccatattgtttgaatac
aattccagcaaattgattactggagggcaggaccgttctattaagatgtgggatacaagc
acgggatcattaagtcacactctttatggttgcttgggttctgttctggatctcactatc
acaaatgataataaaactgtaatagcagctagtagctcaaataacttatatgtttgggat
gtcagctcgggccgaatccgacatacacttacaggacatactgataaagtctgtgcagta
gatgtgagtaaagtatccaatcgacatgttgtcagtgcagcatatgatcgaacaataaaa
gcttgggatttgcagaaaggttattgcactaacacaatcattttcccaagcaattgcaat
gcagtttgtttcagcatggatggaagaacaatatgctcaggtcatgttgatggcaatctc
cggctttgggatatacaaacaggaaagcttctcagtgaggttgctgctcattctcttgct
gtgacatcaatctctttgtctcgaaatggaaacacgattttgacaagtgggagagataat
gtgcataatctgtttgatatgagaacacttgaagtttacggcacattgagggcgagtgga
aacagagtggcatctaactggagcagatcctgtattagtgcagatgacaattatgttgct
gctggatctgctgatggatctgtacatatttggtcaatacagaagggagatatagttagc
actcttaaggaacatggatcatctgttttgtgctgtgcttggagtggtctcggaaagcct
ttggcgacttctgacaagaatggagttatttgcacttggatctga

DBGET integrated database retrieval system