KEGG   Spinacia oleracea (spinach): 110795055Help
Entry
110795055         CDS       T05137                                 

Definition
(RefSeq) probable sesquiterpene synthase
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110795055
Enzymes [BR:soe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110795055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth ANTAR Como_LCP
Motif
Other DBs
NCBI-GeneID: 110795055
NCBI-ProteinID: XP_021855726
Position
Unknown
AA seq 552 aa AA seqDB search
MSGENSENQKSRPIANFHPCHWGHHFLNFENPHHDEEIQAQKEQEVKQLKEEVKKELEET
KGNSVEQLNFIDGIERLGLEYHFENEIEDALKLVFESFHDQCVKDDLYHVSLRFRILRQH
GFFVPCDVLNKFKDENGSFMESIIKDVRGLLSLYEASHVRVHDDKILDEALFFTTTHLNA
VVDELSSPLADQVAHALHQPLHKGMPRVESRHYISIYEKDASHNKTLLKFAKLDFNLLQA
LHQKELKDLTSWWKGLHMKASFGRDRSAEAYLWILGSYHEPQFSFARKIYRKIFKATVLL
DDTYDAYGTVEELQPLTEMFQRSWDKSHVDQLSEHVKWGYCAMVEACEEGEEDLAKLGRS
FCVNYTREQVKALSQAYLQEAIWCDKKYVPTYDEYMKIALVTSPYPHATVACFLGMGDIA
TKEVFEWACQDPMPNVIKAASTILRLMDDLGGHKFEQKRKHVASAVQCLMEKHGMSEEEA
KEKISVEVEDAWKDINQAMLKPYVIPKPLLTRILNLARSADVIYKGTSDGFTQVNQTFRD
KVASVLAHPVPI
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtgaaaactctgaaaaccaaaaatctcgtcccattgccaactttcatccatgt
cattggggtcaccattttcttaatttcgaaaatcctcatcacgacgaggaaatccaagct
cagaaagagcaagaagtgaaacaactgaaagaggaagtgaagaaggagttggaggaaact
aagggcaactcagttgagcagctgaatttcatcgacggcatcgaacgtcttgggctagaa
tatcacttcgaaaatgagattgaggatgcattaaagctggtgtttgagagcttccatgac
caatgtgtcaaagacgatctataccatgtttctttgcgatttcgaattctaaggcaacat
ggcttctttgtgccttgcgatgtgttaaacaagttcaaggatgagaatggaagctttatg
gagtccataatcaaggacgttcgaggattgttaagcttgtatgaggcctcccatgtccga
gttcatgatgacaaaatactcgacgaagcccttttttttactacaactcatctcaacgct
gtggttgacgagttaagctctccacttgcggatcaagttgctcatgcccttcaccaacct
cttcacaaggggatgccccgagtagagtctaggcattacatctccatttatgaaaaggat
gcatctcataataagactctcctcaaatttgcaaagctagatttcaatttgctccaagcc
ttgcaccaaaaggagctaaaagatttaacaagttggtggaaaggactacatatgaaagca
tcatttggtagagataggtcagcagaggcgtatctttggattttaggttcctaccacgaa
ccccaattttcttttgcaaggaaaatttatagaaaaatattcaaggcaactgtactattg
gacgatacatatgatgcttatgggacggttgaagaactccaaccccttactgaaatgttt
caaaggtcatgggacaaaagtcatgtggaccaactttcggagcatgtgaaatggggttat
tgcgcaatggttgaagcatgtgaggaaggtgaggaagatcttgccaaactaggaagatca
ttttgcgttaactatacaagagaacaggtgaaagctttaagccaagcctatttacaagag
gcaatatggtgcgacaaaaaatatgttcctacatatgatgagtatatgaagattgcattg
gtaacatctccctatcctcatgccacagttgcctgtttcctaggcatgggagacattgca
acgaaagaggtatttgaatgggcatgccaagatcctatgcctaatgtcattaaagctgca
tctacaattcttcgactcatggacgacttaggtggccataagtttgaacaaaaaaggaag
catgtggcctcggctgtgcaatgcttgatggagaaacatgggatgtctgaggaggaagca
aaagagaagataagtgtagaagttgaggatgcttggaaagatattaatcaggcgatgctt
aaaccttatgttatcccaaagcctttgctaactcggattctaaacttggctcgttctgcc
gatgttatttataagggtacatctgatggtttcacccaagtcaaccaaacttttagggac
aaagttgcttccgttcttgcccatccggttcccatttga

DBGET integrated database retrieval system