KEGG   Spinacia oleracea (spinach): 110795196Help
Entry
110795196         CDS       T05137                                 

Definition
(RefSeq) uncharacterized protein LOC110795196
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soe01001]
    110795196
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110795196
Protein kinases [BR:soe01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110795196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH TMEM154 LTP_2 Pkinase_fungal ABC1 Haspin_kinase Shisa DUF2207 GTP_EFTU_D2
Motif
Other DBs
NCBI-GeneID: 110795196
NCBI-ProteinID: XP_021855872
Position
Unknown
AA seq 1166 aa AA seqDB search
MESAVNQMKLVVVLLLMQFMGSSSQGMCWQRLSNCNTESSSSSDPMMCCKVLRNDIQNDR
DCFCNVKSTINGNSSIADMMSRLLLSCGVPSSYNTLCPDMGEPSPSSDLLSPETTTTTSD
MGEPSPSSDLLTPESTTTSDVPATPESDRTTALDSTTSSIQRKLHIIIPAVVVAFVAVAI
IVTLVVCLCFCKKKPKPEKPQQVQGNVVVQYEVALPTLTPSVIVPISNVTNDSTYEEVVS
GELPQTPASNNDLVVTAESLQYDLKTLQTATNNFSDHEKIGRGGFGIVYKGILADGREIA
VKRLSNSSSQGDKEFKNEVVLLAKLQHRNLVKLVGFCVADSEKLLVYEFVPNKSLDYFLF
DAQKQAEMNWSIRYNIIKGIARGMLYLHEDSPVRIIHRDLKAGNVLLDAEMNPKIADFGM
ARICAFEQTHIDTSRVVGTYGYMSPEYLLHGQFSTKSDVYSFGVLVLEIVSGRKVCGFIY
QTEGGENLLCYAWKCWLEGKTSELIDPTLRDSCSNEEVMKCVNLGLMCVQEDVTRRPAME
TIAHILNSSFSSSSSSSSSSKAPSMPQPPAFLYSSSSTTTRSTNISLPSSTTWKSDDSHS
IPCEKKGEMKVNKKKCYIEVVLIMVLGMIIMPSSAQFIIGDKAPPCWDTIGSCIGDNVNR
SESEPKLNPSSPKFNFSEYACCTLIQQTAQTQKQCFCYVDTFLHQNPSYQTNITSVFKYC
KVADSLTSLYTFCQDLEDSTPTDVPVSATPSTTGKLKLIIAVTVTSATILVIAIAIGIGI
ALKCKKAKKKPKDEAHSQSATEDVPPAPAPAPAPAPAPVPADDNIVTADSLLYEWEALKD
ATKSFSNDNKIGQGGFGSVYKGTLKNGQEVAVKRLSSGSCQGDKEFKNEVALVAKLQHRN
LVKLEGFCLTKDEEKLLVYEFVVNKSLDFFLFDSEKQILLDWPKRYDIIKGVARGMLYLH
EDSPIRIIHRDLKAANVLLDEEMHPKIADFGMARIFDEKTYCHTSRVIGTYGYMAPEYLI
HGQFNVKSDIYSFGVLVLEIVSGKRISAMTYQSGVAENLLSCGWKCWKDGRSWEFMDPTL
SDTYSKDEITKCIHLGLLCVQEDMRRRPSMSAIALMLNSNFAVGALSTPQPPAFMYCGNA
DQSTMSNTTSVPWSTGTSTNESNTLL
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atggaatctgcagtaaatcagatgaagttagtagtagtattgttgttgatgcaatttatg
ggttcatcatcacaaggaatgtgttggcagaggctatcaaattgtaacacagagtcgtct
tcttcctctgatccaatgatgtgctgtaaagttctaaggaatgatattcagaatgataga
gactgtttctgcaacgtcaagtctactattaatggaaattctagtattgcggatatgatg
tctaggcttctcttgtcttgtggagttccatcttcttataacacactctgccctgatatg
ggagagccttcgccaagttcagacttactgtcaccggaaaccaccaccaccacttcagac
atgggagagccttcgccgagttcagacctactaacaccggaaagcaccaccacttcggat
gtgcctgctacacctgagagtgatcggaccactgcactggattcaacaacatcctcaatt
cagagaaaactccatataataattcctgctgtcgttgttgcatttgtggccgtggctata
atcgtgacactcgtcgtatgtttatgcttttgtaagaagaaacccaaaccagaaaaacct
caacaagtacaaggaaatgtggtggtgcaatatgaggttgctcttccaaccctgactcca
tctgtcatagtcccaatatcaaatgtcacaaatgattctacatatgaggaagtggtttcc
ggtgaattgcctcaaactccggcatcaaataatgatctcgttgtgactgctgaatcactg
caatatgatctgaaaactctgcagacggccaccaacaacttctctgatcatgagaaaatt
ggccggggtggatttggtatcgtttacaagggaatcctagcagatggtagagaaatagca
gttaaaaggctttcgaacagctctagtcaaggtgataaagaattcaagaatgaggtggtg
ttgttagcaaaacttcaacatagaaatctggtaaagcttgtaggattctgtgtagcagac
tctgagaagctactcgtgtacgaattcgtgcccaacaagagcctcgactacttcctattt
gatgctcaaaaacaagcggaaatgaattggtcaatacgttacaatattataaaagggatt
gctcgaggaatgctttaccttcatgaagactcccctgtaagaatcatacaccgtgatctt
aaagctggtaatgtgttgttagatgcggagatgaaccctaaaattgcagattttggtatg
gctaggatttgtgcttttgaacagacacatattgatacaagtcgagttgttggtacttat
ggttatatgtcacctgagtatttacttcacggacaattctccacaaaatcagatgtatac
agctttggtgtgctagtattagagattgttagtgggcgaaaggtttgcggtttcatctat
caaacggaaggaggagaaaaccttttgtgctatgcctggaaatgctggttagaaggaaaa
acatcggaactcatagatccaacattgagagattcatgctcaaatgaggaagtcatgaaa
tgtgtaaatttgggtctaatgtgtgtacaagaggacgttacaaggaggcctgccatggag
acaatagctcacatactcaactctagcttttcttcttcttcttcttcttcttcttcttca
aaggctccttcaatgcctcaaccccctgcattcttgtatagcagcagttcgacaacaaca
agaagcaccaatatttcattgccatcatcaacaacatggaaaagtgacgactcacattca
attccatgtgagaagaaaggggagatgaaagtgaacaagaagaaatgttacatagaagtg
gtgttgattatggtgttgggaatgattataatgccgtcatcagcacagttcattataggg
gacaaagcaccaccatgctgggataccataggaagttgcataggagataatgttaaccgg
agtgaatcagagccaaagctcaacccatccagtcccaagtttaattttagcgaatatgca
tgttgtacactcatccaacagactgctcaaactcaaaagcaatgtttctgttatgtcgac
acctttcttcatcaaaacccctcttaccaaaccaacattacaagtgtcttcaagtattgc
aaggtcgctgattctcttacttctctttacaccttctgccaagatctagaagactcaact
ccaacagatgttcctgtttctgcaactcctagtactacaggaaaactcaaactgattatt
gctgtcactgtaacatcagcaaccatcctagttattgctattgctattggtataggcata
gcccttaagtgtaagaaagccaagaagaaacctaaagatgaagcccattctcaaagtgct
acagaggatgtgccacctgcaccagcacctgcacctgcacctgcacctgcacctgtacct
gcagacgataatattgttacagctgattccttgttgtacgagtgggaagcacttaaggat
gccactaaaagcttctccaatgataacaagattggtcaaggggggttcggcagtgtctac
aagggcaccttaaaaaatggacaagaagtcgccgtgaaaaggctatcaagcggctcttgc
caaggtgacaaagaatttaaaaacgaggttgcattggtagccaagcttcaacacagaaat
ttagtgaagctagaaggattttgcttgacaaaagacgaggaaaagttactcgtttatgag
tttgtggtcaacaaaagtcttgacttcttcctatttgattctgaaaaacaaatactattg
gattggccaaagagatatgacattataaaaggagtggctcgaggaatgctctacctccat
gaagactctcccatccgaatcatccaccgtgatctcaaagcagccaatgttttgttagat
gaagagatgcatcctaaaattgcagactttggcatggctaggatctttgatgaaaaaacc
tattgccatacaagcagagttattgggacttatggttatatggctccggagtatttaatc
cacggacaattcaatgtaaaatcagacatatacagctttggcgtgctagttttggagatt
gtaagtggaaaaaggataagtgccatgacctatcaatccggcgttgctgaaaaccttcta
agctgtggatggaaatgttggaaagatggaagatcatgggagtttatggatccaacacta
agtgacacttactcgaaagatgaaatcacaaagtgcatacatctcggattattatgtgtc
caagaagacatgaggagaaggcctagcatgtctgcaatagcccttatgctcaactctaat
tttgctgttggtgcattgtcaacgcctcaaccacctgctttcatgtattgtgggaatgca
gatcaatcaactatgagtaacacaacttcagtaccatggtctactggaacatcaaccaat
gagtccaatactttattatga

DBGET integrated database retrieval system