KEGG   Spinacia oleracea (spinach): 110797820Help
Entry
110797820         CDS       T05137                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK4
Organism
soe  Spinacia oleracea (spinach)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal APH Syndecan EphA2_TM
Motif
Other DBs
NCBI-GeneID: 110797820
NCBI-ProteinID: XP_021858631
Position
Unknown
AA seq 673 aa AA seqDB search
MADDESSPSPDQSPPSGSSSSSSPDSSPPPPPPTPSSSPPPPVPPSSPPPSPPAPTEDSS
PSPPPPSEEPPSPPTEKSPSPPSPPTEKSPSPPPKKDNNNSGKDNDKKPPPIDRNGGGEP
PKDIPSQPRPPIEQLAPPAPGEPPKDIPSQPRPPIEQLAPPAPLGSSAESPSPSLTDGGS
APRGPSKSNNDGGIITGVVVVSGLLLFLMAVCVVCLRKKKKKSEGIPSYGWDGASKKSQG
NNQYWQSSPHDHHAVKIPPPSGGGGWGHPNGTTSDESGHGPNAAAMAASIPTSPSLTLGF
NKSTFTYGELAAATNGFDRSRMLGQGGFGYVHKGILPNGKEIAVKSLKTGSGQGEREFSA
EVEIISRVHHRHLVSLVGYCIAGGQRMLVYEFVPNDTLEFHLHKKGELDFPTRLRIALGS
AKGLGYLHEDCHPRIIHRDIKASNILLDENYEAMVADFGLAKLTSDTNTHVSTRVMGTFG
YLAPEYASSGKLTEKSDVFSYGVMLLEIITGRRPVDPHMKYMEDSLVDWSRPLLTKALET
GNYHEFVDPRLEGNYDPSLMKRMVACAAASIRHSAKRRPKMSQIVRALEGDVSLEDLNSE
GGKIGQNSMLSSSEGSDYDSRAYSKDLKRFRQMALATQDFASSEYGATTSEYGLNPSSSS
SDNSKEMKSKHIP
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgacgaatcatcaccttcacctgatcaatcaccaccgtcaggatcatcatca
tcgtcatcaccagattcatcaccaccaccaccaccaccaactccttcatcctccccgcca
ccgccagtgccaccctcatcaccacctccgtctcctccggcgccaaccgaagactcatct
ccatctccaccacccccgtcagaggaaccaccatcgccaccaacagagaaatcaccatcg
ccgccatcgccacccacagagaaatcaccatcgccgcctcctaaaaaagataataataat
agtggtaaggacaatgacaaaaaacctccaccaattgatcgtaacggcggtggcgagccg
cctaaggatatcccgtcgcaacctcggccgccgatagaacaactagctccaccggcaccn
ggcgagccgcctaaggatatcccgtcgcaacctcggccgccgatagaacaactagctcca
ccggcaccgctcggttcgtcggctgaatcaccatccccttccttaaccgatggaggctcc
gctcctagagggccgtcgaaatcgaataatgacggtggtatcataaccggagtggtggtg
gttagtggcctcttgctttttctaatggcggtttgtgtagtgtgcttaagaaagaagaag
aaaaagagtgaaggtataccctcttatggttgggatggtgcttctaaaaaatctcaaggt
aacaatcaatattggcaatcatctcctcatgaccaccacgcagtcaagatcccaccacct
tccggcggaggcggttggggacatccaaatggtacaactagcgacgaaagcggacatggc
ccaaatgcggcggcgatggcggcgtcaataccaacatctccaagtctaacactgggtttt
aacaagagcaccttcacctacggcgagctagcggcggcgacgaacgggttcgataggtcg
aggatgttagggcaaggtggtttcggatacgtacacaagggtattttacctaacggaaaa
gagatcgccgttaaaagccttaaaactggtagtggacaaggagagagagaattttcggcg
gaagttgagattattagtcgtgttcatcatcgacatcttgtatccttggtgggttattgt
attgctggtggacaacggatgttggtctatgagtttgttcctaatgacactttggaattc
cacctccataaaaaaggtgaattggattttccaactaggcttcgcattgcacttggatcg
gctaaagggcttggttatcttcatgaagattgtcacccaagaatcatccatcgtgacatc
aaagcttctaatattttgttggatgaaaactatgaggccatggttgctgactttggacta
gctaagcttacctctgatacaaacacccacgtctctactcgtgtgatgggaacttttggg
tatttggctccagagtatgcttcaagtggcaagctaacagaaaagtcggatgttttctca
tatggtgtcatgttgctagaaattataactggacgtcgaccagttgaccctcacatgaag
tacatggaagatagcttggttgattggtccaggccgctcctaacaaaagccttggaaact
gggaactaccatgagtttgttgatccacgtttggagggaaactatgacccgagtttaatg
aaacgaatggtagcttgtgctgctgcatccattcgccattctgctaagaggcgtcctaaa
atgagccagattgttcgagcattggaaggagatgtctcacttgaagacctaaatagtgaa
ggtggaaagatagggcaaaactcaatgttaagctcatcagagggctcagattatgattct
cgtgcatatagtaaagatctaaagaggttcagacaaatggcattggcaactcaagatttt
gcaagcagtgaatatggagcaaccactagcgaatacgggttgaacccgtctagtagctca
agcgacaattcaaaagagatgaaaagcaaacatataccctaa

DBGET integrated database retrieval system